JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

MmTx2 Toxin

SKU : BHP21300257

A Super Potent Allosteric Modulator of GABA(A) Receptors

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STM-600, STM-600_0.1 mg, STM-600_0.5 mg, STM-600_1 mg, STM-600_50 mcg
Description	A Super Potent Allosteric Modulator of GABA(A) Receptors
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C295H450N94O97S10
Background	MmTx2 (Micrurotoxin 2) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venoM The toxin is an allosteric modulator of gamma-aminobutyric acid type A receptors and tightly binds to these receptors at subnanomolar concentrations. MmTx2 allosterically increases GABA(A) receptor susceptibility to agonistic actions1. Like MmTx1 (#STM-550), MmTx2 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.
Biological Activity	MmTx2 is a potent allosteric modulator of GABA(A) receptors1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	7186 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	C0HJR2
Concentration	100 - 400 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63
Origin	Micrurus mipartitus (Red-tailed coral snake)

Synonyms	Micrurotoxin 2
Gene Id	GABR,GABRA1,GABRB2
Sequence	LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN-OH
Target	GABA(A) receptors

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891. Middendorp, S.J. et al. (2015) Neuropharmacology 95, 459.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300257-1	STM-600_0.1 mg	0.1 mg	$543		Add to Cart
BHP21300257-2	STM-600_0.5 mg	0.5 mg	$1885		Add to Cart
BHP21300257-3	STM-600_1 mg	1 mg	$2670		Add to Cart
BHP21300257-4	STM-600_50 mcg	50 mcg	$337		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.