JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

MmTx1 Toxin-ATTO Fluor-488

SKU : BHP21300256

A Super Potent Allosteric Modulator of GABA(A) Receptors Conjugated to the Fluorescent Dye ATTO-488

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STM-550-AG, STM-550-AG_10 mcg, STM-550-AG_5 mcg
Description	A Super Potent Allosteric Modulator of GABA(A) Receptors Conjugated to the Fluorescent Dye ATTO-488
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Background	MmTx1 (Micrurotoxin 1) is a peptide toxin originally isolated from Micrurus mipartitus (Red-tailed coral snake) venoM The toxin is an allosteric modulator of gamma-aminobutyric acid type A receptors (GABA(A)) and tightly binds to GABA(A) receptors at subnanomolar concentrations. MmTx1 allosterically increases GABA(A) receptor susceptibility to agonistic actions, thereby potentiating receptor opening and desensitization by interacting with the alpha+/beta?interface, a benzodiazepine-like binding site1. MmTx1 may be a priceless tool in evoking seizures for testing novel antiepileptic drugs or as lead molecules for designing therapeutics that modulate GABA(A) receptor activity1.GABA(A) receptors belong to the cys-loop pentameric ligand-gated ion channel family. These receptors are major inhibitory neurotransmitter receptors in the brain and in the mammalian central nervous system and are responsible for the mediation of GABA action, a major inhibitory neurotransmitter, through the central nervous system2.
Biological Activity	MmTx1 is a potent allosteric modulator of GABA(A) receptors1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	~7775 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Source	Modified synthetic peptide
Concentration	200 - 400 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys24, Cys6-Cys11, Cys17-Cys41, Cys45-Cys57, Cys58-Cys63 ATTO Fluor-488
Origin	Micrurus mipartitus (Red-tailed coral snake)

Synonyms	Micrurotoxin 1
Gene Id	GABR,GABRA1,GABRB2
Sequence	LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCCTRDNCN-OH
Target	GABA(A) receptors

Country Of Origin	Israel/IL
Storage	Storage After Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light. Storage of solutions: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.

Applications	Electrophysiology, Live cell imaging, Immunofluorescence, Direct flow cytometry

Reference	Rosso, J.P. et al. (2015) Proc. Natl. Acad. Sci. U.S.A. 112, E891. Middendorp, S.J. et al. (2015) Neuropharmacology 95, 459.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300256-1	STM-550-AG_10 mcg	10 mcg	$337		Add to Cart
BHP21300256-2	STM-550-AG_5 mcg	5 mcg	$235		Add to Cart
BHP21300256-3	STM-550-AG_10 mcg	2x10 mcg	$543		Add to Cart
BHP21300256-4	STM-550-AG_10 mcg	5x10 mcg	$1083		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.