JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

MitTx Toxin

SKU : BHP21300071

An Activator of ASIC1-Containing Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	M-100, M-100_0.1 mg, M-100_0.25 mg, M-100_0.5 mg, M-100_10 mcg, M-100_20 mcg, M-100_50 mcg
Description	An Activator of ASIC1-Containing Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Background	alpha/beta MitTx (MitTx toxin) is a natural toxin isolated from the Texas Coral snake venom1. The purified active toxin consists of a heteromeric complex between Kunitz (alpha subunit) and phospholipase-A2-like (beta subunit) proteins that together function as a potent, persistent and selective agonist for acid-sensing ion channels (ASICs), showing equal or greater efficacy compared with acidic pH1.MitTx-alpha and MitTx-beta form a high affinity 1:1 complex, and neither subunit demonstrates functional effects on its own1,2.The purified ASIC-activating component of the venom, MitTx, was found to be sufficient to elicit robust nocifensive behaviors and is likely responsible for the lasting pain experienced by victims of coral snake envenomation2.
Biological Activity	MitTx toxin activates ASIC1-containing channels1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	20.84 kDa (Î± subunit, 7.104 kDa and Î² subunit, 13.736 kDa)
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Natural protein
Accession Number	G9I930
Concentration	20 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: yes Cited Application: Electrophysiology Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	MitTx-Î± subunit contains pyrrolidone carboxylic acid at the N-terminus.
Origin	Micrurus tener tener (Texas coral snake).

Synonyms	MitTx, alpha/beta MitTx
Gene Id	ASIC1,ASIC1a,ASIC1b,ASIC2a,ASIC3
Sequence	MitTx-Î± subunit:QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG MitTx-Î² subunit:NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ
Target	ASIC1 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Bohlen, C.J. et al. (2011) Nature 479, 410. Bohlen, C.J. and Julius, D. (2012) Toxicon 60, 254. Bohlen, C.J. et al. (2011) Nature 479, 410. Bohlen, C.J. and Julius, D. (2012) Toxicon 60, 254.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300071-1	M-100_0.1 mg	0.1 mg	$838		Add to Cart
BHP21300071-2	M-100_0.25 mg	0.25 mg	$1337		Add to Cart
BHP21300071-3	M-100_0.5 mg	0.5 mg	$2140		Add to Cart
BHP21300071-4	M-100_10 mcg	10 mcg	$185		Add to Cart
BHP21300071-5	M-100_20 mcg	20 mcg	$262		Add to Cart
BHP21300071-6	M-100_50 mcg	50 mcg	$524		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.