JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Mambalgin-3

SKU : BHP21300254

A Blocker of ASIC1a and ASIC1b Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STM-500, STM-500_0.1 mg, STM-500_0.5 mg, STM-500_1 mg, STM-500_5 mg, STM-500_50 mcg
Description	A Blocker of ASIC1a and ASIC1b Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C274H433N85O83S10
Background	Mambalgin-3 is a peptide toxin originally isolated from the green mamba (Dendroaspis augusticeps) snake venom1. The toxin inhibits rat ASIC1a (IC50 = 17 nM), ASIC1b (IC50 = 44 nM) and heteromeric ASIC1a-ASIC2a (IC50 = 252 nM) channels1.Acid-sensing ion channels (ASICs) are voltage-independent proton-gated cation channels that are largely expressed in the nervous system as well as in some non-neuronal tissues. In rodents, six different isoforms (ASIC1a, 1b, 2a, 2b, 3 and 4) can associate into homo- or hetero-trimers to form a functional channel1.Mambalgins define a new structural and functional class among snake three-finger toxins. These type of toxins are found in snake venoms (Mambalgin1 and 2 were originally isolated from black mambas) and are characterized by their distinctive structure2. Mambalgins are the only three-finger toxins to target ASIC channels and show no neurotoxic effect. These three-finger toxins show an analgesic effect against acute and inflammatory pain upon central and peripheral injection that can be as strong as morphine. Mambalgins cause much less tolerance than morphine and no respiratory distress3.
Biological Activity	A blocker of ASIC1-containing channels1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6566.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	C0HJB0
Concentration	10 - 50 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys19, Cys12-Cys37, Cys41-Cys49 and Cys50-Cys55
Origin	Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Synonyms	Mamb-3
Gene Id	ASIC1a,ASIC1b
Sequence	LKCYQHGKVVTCHRDMKFCYHNIGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK-OH
Target	ASIC1a and ASIC1b channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Kini, R.M. et al. (2010) Toxicon 56, 855. Diochot, S. et al. (2012) Nature 490, 552. Baron, A. et al. (2013) Toxicon 75, 187. Baron, A. et al. (2013) Toxicon doi: 10.1016/j.toxicon.2013.04.008. Diochot, S. et al. (2012) Nature 490, 552.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300254-1	STM-500_0.1 mg	0.1 mg	$492		Add to Cart
BHP21300254-2	STM-500_0.5 mg	0.5 mg	$1873		Add to Cart
BHP21300254-3	STM-500_1 mg	1 mg	$3144		Add to Cart
BHP21300254-4	STM-500_5 mg	5 mg	$9564		Add to Cart
BHP21300254-5	STM-500_50 mcg	50 mcg	$287		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.