JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Mambalgin-2

SKU : BHP21300253

A Selective and Reversible ASIC1a Channel Blocker

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STM-400, STM-400_0.1 mg, STM-400_0.5 mg, STM-400_1 mg, STM-400_10 mg, STM-400_5 mg, STM-400_50 mcg
Description	A Selective and Reversible ASIC1a Channel Blocker
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C272H429N85O83S10
Background	Mambalgin-2 is a peptide toxin originally isolated from Dendroaspis polylepis (Black mamba) venoM It is a selective and potent ASIC1a blocker2. Mambalgins belong to the three-finger toxin family, albeit their limited structural similarity3. Molecular docking of mambalgin-2 is predicted to interact with the acidic binding pocket of ASIC1a2. Further mutagenesis studies in chimeric proteins uncovered the interactions of mambalgin-2 with beta-ball and Palm regions of ASIC1a that are associated with a pH sensing property2.Acid-sensing ion channels (ASICs) are proton-gated sodium channels1. They are abundant in the central as well as in the peripheral nervous systems and are sensitive to environmental pH1.Environmental pH can change dramatically due to certain circumstances such as inflammatory condition as evident during epileptic seizures or tumor outgrowth3. In such cases, ASICs transform into their open conformation and import sodium ions, which then elicit neuronal action potential3.
Biological Activity	Mambalgin-2 is a blocker of ASIC1 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6538.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	P0DKS3
Concentration	20 - 300 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys19, Cys41-Cys49 and Cys50-Cys55
Origin	Dendroaspis polylepis polylepis (Black mamba)

Synonyms	Ma-2, Mamb-2, Pi-Dp2
Gene Id	ASIC1a
Sequence	LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK-OH
Target	ASIC1 Channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Baron, A. et al. (2013) Toxicon 75, 187. Salinas, M. et al. (2014) J. Biol. Chem. 289, 13363. Vullo, S. and Kellenberger, S. Pharmacol. Res. (2019) pii: S1043-6618(18)31948-0. Salinas, M. et al. (2014) J. Biol. Chem. 289, 13363.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300253-1	STM-400_0.1 mg	0.1 mg	$492		Add to Cart
BHP21300253-2	STM-400_0.5 mg	0.5 mg	$1873		Add to Cart
BHP21300253-3	STM-400_1 mg	1 mg	$3144		Add to Cart
BHP21300253-4	STM-400_10 mg	10 mg	$13342		Add to Cart
BHP21300253-5	STM-400_5 mg	5 mg	$9564		Add to Cart
BHP21300253-6	STM-400_50 mcg	10 mcg	$325		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.