JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Mambalgin-1

SKU : BHP21300248

A Selective and Reversible ASIC1a Blocker

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STM-100, STM-100_0.1 mg, STM-100_0.25 mg, STM-100_0.5 mg, STM-100_1 mg, STM-100_10 mg, STM-100_5 mg, STM-100_50 mcg
Description	A Selective and Reversible ASIC1a Blocker
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C272H429N85O84S10
Background	Mambalgin-1 is a 57-residue peptide toxin originally isolated from the black mamba snake venoM It is a selective and reversible acid-sensing ion channel 1 (ASIC1) channel blocker. It binds to the closed state of the channel. The binding induces strong shift of the pH-dependent activation of ASIC1 channel towards a more acidic pH. Mambalgin-1 inhibits homomeric rat ASIC1a, rat ASIC1b, and heteromeric rat ASIC1a + ASIC2a channels heterologously expressed in Xenopus oocytes with an IC50 values of 3.4 ± 0.6, 22.2 ± 1.7, and 152 ± 21 nM, respectively2.In mice, Mambalgin-1 is not toxic, but poses analgesic effects upon central and peripheral injection found to be as strong as morphine1,2.ASIC channels are proton-gated Na+ channels directly activated by extracellular protons. They are expressed throughout the CNS and the peripheral nervous systeM The channels are involved in a variety of physiological and pathophysiological processes including synaptic plasticity, neuronal injury, nociception and mechanoperception2.
Biological Activity	Mambalgin-1 is a blocker of ASIC1 channels1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6554.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	P0DKR6
Concentration	50 - 200 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	1609937-15-6
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38
Origin	Dendroaspis polylepis polylepis (Black mamba)

Synonyms	Mamb-1, Pi-Dp1, Mambalgin 1
Gene Id	ASIC1a
Sequence	LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK-OH
Target	ASIC1 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Diochot, S. et al. (2012) Nature 490, 552. Mourier, G. et al. (2016) J. Biol. Chem. 291, 2616.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300248-1	STM-100_0.1 mg	0.1 mg	$218		Add to Cart
BHP21300248-2	STM-100_0.25 mg	0.25 mg	$435		Add to Cart
BHP21300248-3	STM-100_0.5 mg	0.5 mg	$697		Add to Cart
BHP21300248-4	STM-100_1 mg	1 mg	$1210		Add to Cart
BHP21300248-5	STM-100_10 mg	10 mg	$7739		Add to Cart
BHP21300248-6	STM-100_5 mg	5 mg	$4837		Add to Cart
BHP21300248-7	STM-100_50 mcg	50 mcg	$152		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.