JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

m3-Huwentoxin IV

SKU : BHP21300215

A Potent and Selective NaV1.7 Channel Blocker

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STH-102, STH-102_0.1 mg, STH-102_0.5 mg, STH-102_1 mg, STH-102_10 mg, STH-102_5 mg, STH-102_50 mcg
Description	A Potent and Selective NaV1.7 Channel Blocker
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C170H271N53O46S6
Background	Huwentoxin IV is a peptide toxin originally isolated from the venom of the Chinese bird-eating spider Haplopelma schmitdi that acts as a potent and selective NaV1.7 channel blocker displaying an IC50 value of 26 nM1. m3-Huwentoxin IV is a mutated form of the toxin with significant increased potency towards NaV1.7, displaying an IC50 value of 0.4 nM1.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. These channels responsible for propagating action potentials in excitable cells and considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as cardiac arrhythmia, and epilepsy2,3.NaV1.7 channel plays an important role in the human pain signaling pathway and it is an important therapeutic target for the treatment of chronic pain2,3.
Biological Activity	m3-Huwentoxin IV is a mutated form of the Huwentoxin IV with significant increased potency towards NaV1.7, displaying an IC50 value of 0.4 nM1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3986 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P83303
Concentration	3 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31 Ile35 - C-terminal amidation
Origin	Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)

Synonyms	Mutated Huwentoxin-IV, Triple-mutated Huwentoxin-IV, m3-HwTx-IV, m3-Huwentoxin-IV
Gene Id	SCN9A
Sequence	GCLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQI-NH2
Target	NaV1.7 channel

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Rahnama, S. et al. (2017) PLoS One 12, e0173551. Chow, C.Y. et al. Toxins (2015) 7, 2494. Klint J.K. et al. (2015) Br. J. Pharmacol. 172, 2445. Rahnama, S. et al. (2017) PLoS One 12, e0173551.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300215-1	STH-102_0.1 mg	0.1 mg	$235		Add to Cart
BHP21300215-2	STH-102_0.5 mg	0.5 mg	$798		Add to Cart
BHP21300215-3	STH-102_1 mg	1 mg	$1275		Add to Cart
BHP21300215-4	STH-102_10 mg	10 mg	$6251		Add to Cart
BHP21300215-5	STH-102_5 mg	5 mg	$4467		Add to Cart
BHP21300215-6	STH-102_50 mcg	50 mcg	$184		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.