JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

KTX-Sp2

SKU : BHP21300245

A Potent Blocker of KV1.3 and a weaker blocker of KV1.1 and KV1.2

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STK-050, STK-050_0.1 mg, STK-050_0.5 mg, STK-050_1 mg, STK-050_10 mg, STK-050_5 mg
Description	A Potent Blocker of KV1.3 and a weaker blocker of KV1.1 and KV1.2
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C155H244N58O49S7
Background	a-KTX 12 Sp2 (KTX-Sp2) is a 37 amino acid peptidyl toxin, which was originally screened and genetically engineered from the venom gland transcriptome database from the scorpion, Scorpiops Pocoki1. KTX-Sp2 effectively blocks the voltage-gated potassium (Kv) channel Kv1.3, and also weakly inhibits the Kv1.1 and Kv1.2 channels1. In a Jurkat T cell model system, KTX-Sp2 significantly reduced the levels of intracellular free calcium, inhibited cellular activation, and suppressed the release of the inflammatory cytokine interleukin (IL)-2, which exhibited a robust immunosuppressant effect1.Kv channels play key roles in human physiology and pathology. The therapeutic targeting of KV1.3 with specific peptides and small molecule inhibitors shows great promise for treating various cancers and autoimmune diseases, such as multiple sclerosis, type I diabetes mellitus, psoriasis, contact dermatitis, rheumatoid arthritis, and myasthenia gravis2,3,4. In addition, the Kv1.3 channel in T lymphocytes is a validated therapeutic target for diverse autoimmune diseases5 and Ktx-Sp2 robustly inhibits the autoimmune response1.
Biological Activity	KTX-Sp2 is a potent blocker of Kv1.3 voltage-gated K+ channels and a weaker inhibitor of Kv1.1 and Kv1.2 channel1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3928.5 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0DQN5
Concentration	15 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35
Origin	Scorpiops pococki (Scorpion)

Synonyms	Potassium channel toxin alpha-KTX 12 Sp2
Gene Id	KCNA1 ,KCNA2 ,KCNA3
Sequence	SPLHGAKCSSSNQCTRPCRYGGGTHGKCMNGRCRCYG-OH
Target	Kv1.3, Kv1.2, Kv1.1

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Zhang, Y. and Zhang, F. et al. (2019) Cell Biosci., 9, 99. Tajti, G. and Wai, D.C.C. et al. (2020) Biochem. Pharmac., 181, 114146. Norton, R.S. (2017) Neuropharmac., 127, 124. Gubi?, S. et al. (2021) Med. Res. Rev., 1. Chandy, K.G. et al. (2017) Curr. Opin. Chem. Biol., 38, 97. Zhang, Y. and Zhang, F. et al. (2019) Cell Biosci., 9, 99.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300245-1	STK-050_0.1 mg	0.1 mg	$229		Add to Cart
BHP21300245-2	STK-050_0.5 mg	0.5 mg	$702		Add to Cart
BHP21300245-3	STK-050_1 mg	1 mg	$1036		Add to Cart
BHP21300245-4	STK-050_10 mg	10 mg	$5074		Add to Cart
BHP21300245-5	STK-050_5 mg	5 mg	$3603		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.