JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Jingzhaotoxin-XII

SKU : BHP21300238

A Blocker of KV4.1 and NaV1.5 Voltage-Gated Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STJ-100, STJ-100_0.1 mg, STJ-100_50 mcg
Description	A Blocker of KV4.1 and NaV1.5 Voltage-Gated Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C161H227N41O44S7
Background	Voltage-gated K+ (KV) channels play important roles in regulating the excitability of myocytes and neurons. KV channel alpha subunits are divided into four major subfamilies, KV1 through KV41. The KV4 (Shal) subfamily comprises three distinct genes, KV4.1, KV4.2, and KV4.32.Voltage-gated Na+ channels play an important role in generating action potentials. NaV channels consists nine different alpha subunits, NaV1.1 through NaV1.93.Jingzhaotoxin-XII (JZTX-XII), a 29-residue polypeptide, isolated from the venom of Chinese tarantula Chilobrachys jingzhao. JZTX-XII is specific for the Kv4.1 channel and has high selectivity to the NaV channel isoform expressed in cardiac myocytes. It interacts with the channels by modifying the gating behavior4. JZTX-XII blocks KV4.1 currents with an IC50 value of 363 nM in X. laevis oocytes5 and can inhibit NaV1.5 with an IC50 value of 348 nM6.
Biological Activity	Jingzhaotoxin-XII inhibits KV4.1 and NaV1.5 voltage-gated channels1,2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3665.3 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0C5X7
Concentration	200 nM - 2 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25 Leu29 - C-terminal amidation
Origin	Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synonyms	Kappa-theraphotoxin-Cg2a, Kappa-TRTX-Cg2a, Jingzhaotoxin-12, JZTX-12, JZTX-XII, Jingzhaotoxin-45, JZTX-45, Peptide F4-20.99
Gene Id	KCNB1,KCND1,KCND2,SCN5A
Sequence	YCQKWMWTCDSERKCCEGYVCELWCKYNL-NH2
Target	KV4.1, NaV1.5 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Zhou, W. et al. (2004) Neuron 41, 573. Serodio, P. et al. (1998) J. Neurophysiol. 79, 1081. Rong, M. et al. (2011) FASEB J. 25, 3177. Liao, Z. et al. (2007) Toxicon 1, 1. Yuan, C. et al. (2007) Toxicon 50, 646. Xiao, Y. et al. (2004) J. Biol. Chem. 279, 26220. Chen, J. et al. (2008) Cell. Mol. Life Sci. 65, 2431. Yuan, C. et al. (2007) Toxicon 50, 646. Chen, J. et al. (2008) Cell. Mol. Life Sci. 65, 2431. Yuan, C. et al. (2007) Toxicon 50, 646.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300238-1	STJ-100_0.1 mg	0.1 mg	$990		Add to Cart
BHP21300238-2	STJ-100_50 mcg	50 mcg	$317		Add to Cart
BHP21300238-3	STJ-100_50 mcg	5x50 mcg	$1255		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.