JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Jingzhaotoxin XI

SKU : BHP21300242

A Blocker of NaV1.5 and KV2.1 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STJ-400, STJ-400_0.1 mg, STJ-400_0.5 mg, STJ-400_1 mg, STJ-400_5 mg
Description	A Blocker of NaV1.5 and KV2.1 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C158H234N44O47S7
Background	Jingzhaotoxin XI (JzTx-XI) is a 34-residue peptide toxin originally isolated from the Chinese tarantula Chilobrachys jingzhao venoM Jingzhaotoxin XI toxin can potently inhibit both voltage-gated Na+ channel NaV1.5 with an IC50 value of 124 ± 26 nM and voltage-gated K+ channel KV2.1 with an IC50 value of 390 ± 60 nM1,2,3.The mature toxin contains six cysteine residues linked through disulfide bridges and a hydrophobic patch surrounded by charged residues such as Arg or Lys. Jingzhaotoxin XI is a useful tool for investigating the promiscuity of spider toxins2.JzTx-XI has confirmed activity at ion channels known to be important for pancreatic beta-cell function and insulin signaling, such as the delayed potassium rectifier channel (Kv2.1) and the voltage-gated sodium channel (NaV). The peptide is believed to adopt a characteristic inhibitor cysteine knot (ICK) structure as a result of the six cysteine residues present, which is considered to provide effective resistance against circulating enzymatic breakdown and increase therapeutic utility. JzTx-XI has been shown to increase intracellular calcium influx in beta-cells, although less effectively than Jingzhaotoxin IX (#STJ-300), without directly inducing beta-cell depolarization, as well as protect against cytokine-induced beta-cell apoptosis. Jingzhaotoxin XI has also been shown to augment exenatide-induced appetite suppressive actions and enhance the ability of exenatide to curb appetite in overnight fasted mice4.KV2.1 channels play an important role in neuronal systems including the neural retina. The channel's functions include regulation of neuronal excitability and neural transmitter release5.NaV1.5 channels are important in generating and propagating action potentials in excitable cells, in working myocardium and cardiac tissue conduction cells6.
Biological Activity	Jingzhaotoxin XI is a blocker of voltage-gated Na+ channel NaV1.5 with an IC50 value of 124 ± 26 nM and voltage-gated K+ channel KV2.1 with an IC50 value of 390 ± 60 nM1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3726.3 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0C247
Concentration	0.5 - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2- Cys16, Cys9- Cys21, Cys15- Cys28 Phe34 - C-terminal amidation
Origin	Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synonyms	JzTx-XI, kappa-Theraphotoxin-Cg1a 1, kappa-TRTX-Cg1a, Jingzhaotoxin-11, JZTX-11, Jingzhaotoxin-XI, JZTX-XI
Gene Id	KCNB1,SCN5A
Sequence	ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF-NH2
Target	KV2.1 and NaV1.5 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Tao, H. et al. (2016) Toxicon 124, 8. Liao, Z. et al. (2006) Biochemistry 45, 15591. Tang, C. et al. (2014) Toxicon 92, 6. Parkhill-Coulter, A. et al. (2023) Eur. J. Pharmacol., 954,175855. Liu, X. et al. (2017) Oncotarget 8, 59345. Wang, J. et al. (2017) Mol. Med. Rep. 16, 719. Tao, H. et al. (2016) Toxicon 124, 8.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300242-1	STJ-400_0.1 mg	0.1 mg	$247		Add to Cart
BHP21300242-2	STJ-400_0.5 mg	0.5 mg	$969		Add to Cart
BHP21300242-3	STJ-400_1 mg	1 mg	$1353		Add to Cart
BHP21300242-4	STJ-400_5 mg	5 mg	$4722		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.