JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Jingzhaotoxin-IX

SKU : BHP21300241

A Blocker of NaV1.4, NaV1.5 and KV2.1 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STJ-300, STJ-300_0.1 mg, STJ-300_0.5 mg, STJ-300_1 mg, STJ-300_50 mcg, STJ-300_5 mg
Description	A Blocker of NaV1.4, NaV1.5 and KV2.1 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C171H251N49O48S6
Background	Jingzhaotoxin-IX (JZTX-IX) is a neurotoxin, C-terminally amidated peptide composed of 35 amino acid residues. JZTX-IX was originally purified from the venom of the tarantula Chilobrachys jingzhao, one of the most venomous spiders in China.Jingzhaotoxin-IX interacts with several types of ion channels, such as NaV channels, tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms and KV2.1 channels.Binding of JZTX-IX toxin to the ion channel can shift the voltage dependence of channel activation to a more positive voltage and is not reversible by extreme depolarization. 10 uM of the toxin is sufficient for a total blockade of the ion channels at resting point without pulsing.JZTX-IX has confirmed activity at ion channels known to be important for pancreatic beta-cell function and insulin signaling, such as the delayed potassium rectifier channel (Kv2.1) and the voltage-gated sodium channel (NaV). The peptide is believed to adopt a characteristic inhibitor cysteine knot (ICK) structure as a result of the six cysteine residues present, which is considered to provide effective resistance against circulating enzymatic breakdown and increase therapeutic utility. JZTX-IX has been shown to significantly increase intracellular calcium influx in beta-cells without directly inducing beta-cell depolarization, as well as increase beta-cell proliferation and protect against cytokine-induced beta-cell apoptosis. Jingzhaotoxin IX has also been shown to augment exenatide-induced appetite suppressive actions and enhance the ability of exenatide to curb appetite in overnight fasted mice2.
Biological Activity	Jingzhaotoxin-IX blocks NaV1.4, NaV1.5 and KV2.1 voltage-gated channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3953.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0CH44
Concentration	0.5 - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys29 Phe35 - C-terminal amidation
Origin	Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synonyms	Jingzhaotoxin-9, JzTx-9, JzTx-IX, Peptide F6-16.24, U18-TRTX-Cg1a, Jingzhaotoxin-32, JZTX-32
Gene Id	KCNB1,SCN4A,SCN5A
Sequence	ECTKLLGGCTKDSECCPHLGCRKKWPYHCGWDGTF-NH2
Target	NaV1.4, NaV1.5, KV2.1 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Deng, M. et al. (2009) Neuropharmacology 57, 77. Parkhill-Coulter, A. et al. (2023) Eur. J. Pharmacol., 954, 175855. Deng, M. et al. (2009) Neuropharmacology 57, 77.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300241-1	STJ-300_0.1 mg	0.1 mg	$615		Add to Cart
BHP21300241-2	STJ-300_0.5 mg	0.5 mg	$2033		Add to Cart
BHP21300241-3	STJ-300_1 mg	1 mg	$3252		Add to Cart
BHP21300241-4	STJ-300_50 mcg	50 mcg	$388		Add to Cart
BHP21300241-5	STJ-300_5 mg	5 mg	$9756		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.