JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Huwentoxin-I

SKU : BHP21300212

An Antagonist of TTX-Sensitive NaV Channels, N-Type Ca2+ Channels and nAChRs

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STH-050, STH-050_0.1 mg, STH-050_0.25 mg, STH-050_0.5 mg, STH-050_1 mg, STH-050_10 mg, STH-050_5 mg
Description	An Antagonist of TTX-Sensitive NaV Channels, N-Type Ca2+ Channels and nAChRs
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C161H246N48O44S6
Background	Huwentoxin-I (HwTx-I) is a 33-residue peptide toxin that was originally isolated from the venom of the Chinese bird spider (Ornithoctonus huwena). Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated Na+ channels (TTX-S) with IC50 values of ~50 nM and N-type voltage-sensitive Ca2+ channels with IC50 values of ~100 nM in mammalian DRG, hippocampus and insect DUM neurons1. It has only a very weak effect on L-type Ca2+ channels, no effect on TTX-R channels and has virtually no effect on muscle Na+ channels. The selectivity of Huwentoxin-I for Ca2+ channels appears to be higher than omega-conotoxin MVIIA and equivalent to omega-conotoxin GVIA2. Huwentoxin-I demonstrates an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~0.28 ug/kg), without side effects of the ones caused by omega-conotoxin MVIIA3.Huwentoxin-I also blocks neuromuscular transmission by acting on nAChR4.
Biological Activity	An inhibitor of TTX-sensitive voltage-gated Na+ channels and N-type voltage-gated Ca2+ channels1. Also found to block neuromuscular transmission2.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3750 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P56676
Concentration	50 - 200 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, and Cys16-Cys29
Origin	Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)

Synonyms	u/omega-Theraphotoxin-Hs1a, u/omega-TRTX-Hh1a, Huwentoxin-1, HwTx-I, Mu/omega-theraphotoxin-Hs1a
Gene Id	CACNA1B,SCN1A,SCN2A,SCN3A,SCN4A,SCN8A,SCN9A
Sequence	ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL-OH
Target	N-type CaV, TTX-sensitive NaV channels, nAChR

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Wang, M. et al. (2012) Peptides 34, 19. Meng, E. et al. (2011) PLoS One 6, e21608. Chen, J.Q. et al. (2005) Toxicon 45, 15. Zhou, P.A. et al. (1997)Toxicon 35, 39. Wang, M. et al. (2007) Biochem. Biophys. Res. Comm. 357, 579. Zhou, P.A. et al. (1997) Toxicon 35, 39.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300212-1	STH-050_0.1 mg	0.1 mg	$185		Add to Cart
BHP21300212-2	STH-050_0.25 mg	0.25 mg	$384		Add to Cart
BHP21300212-3	STH-050_0.5 mg	0.5 mg	$626		Add to Cart
BHP21300212-4	STH-050_1 mg	1 mg	$1001		Add to Cart
BHP21300212-5	STH-050_10 mg	10 mg	$6399		Add to Cart
BHP21300212-6	STH-050_5 mg	5 mg	$3999		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.