JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

human GDNF proDomain

SKU : BHP21300119

Human Glial-Derived Neurotrophic Factor proDomain, Synthetic

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPG-100, SPG-100_10 mcg
Description	Human Glial-Derived Neurotrophic Factor proDomain, Synthetic
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Molecular Formula	C279H433N79O86S2
Background	Glial-Derived Neurotrophic Factor (GDNF) is a member of the TGF-beta superfamily. GDNF signals through a multi-component receptor system, composed of a RET protooncogene and one of the four alpha1-alpha4 receptors1.GDNF promotes survival of various neuronal cells, including motoneurons2,3, Purkinje cells and sympathetic neurons4. In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake5. Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells6, neurons, pinealocytes, and skeletal muscle cells7.In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from death8. GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons9,10.Recently, it has been hypothesized that functional, carboxy-terminally amidated peptides are processed from the GDNF precursor upon proteolytic cleavage by furin-like endopeptidase11,12,13. Those different peptides (a 5-mer and 11-mer) have not been isolated endogenously to date. However, the rat 11-mer sequence (named brain excitatory peptide, BEP) significantly induced synaptic excitability and possessed some dopaminergic activities in vitro (thus named dopamine neuron stimulating peptides, DNSP)13. Furthermore, the human 11-mer sequence (named DNSP-11) exhibits neurotrophic-like properties13.Thus, the role of the full proDomain of GDNF, which is a product of proteolytic cleavage of proGDNF, is not clearly understood yet.
Biological Activity	Different peptides which are part of the GDNF proDomain sequence can induce synaptic excitability and possess some dopaminergic activities in vitro (thus named dopamine neuron-stimulating peptides), in addition to possessing neurotrophic-like properties1-3.
Formulation	Lyophilized Powder.
Molecular Weight	6334 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Source	Synthetic protein
Form	Lyophilized
Notes	Steril endotoxin free: yes Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Sequence	FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRL-OH

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reference	Airaksinen, M.S. et al. (2002) Nat. Rev. Neurosci. 3, 383. Henderson, C.E. et al. (1994) Science 266, 1062. Houenou, L.J. et al. (1996) Cell. Tissue Res. 286, 219. Kobayashi, M. et al. (2000) Neuroreport 11, 2541. Tomac, A. et al. (1995) Nature 373, 335. Zhou, F.Q. et al. (2003) Cell 113, 814. Lin, L.F. et al. (1993) Science 260, 1130. Matheson, C.R. et al. (1997) Neuroreport 8, 1739. Brundin, P. (2002) Brain 125, 2149. Grondin, R. et al. (1998) J. Neurol. 245, P35. Bradley, L.H. et al. (2010) PLoS ONE 5, e9752. Immonen, T. et al. (2008) Exp. Neurol. 210, 793. Kelps, K.A. et al. (2011) Neuropeptides 45, 213. Bradley, L.H. et al. (2010) PLoS ONE 5, e9752. Immonen, T. et al. (2008) Exp. Neurol. 210, 793. Kelps, K.A. et al. (2011) Neuropeptides 45, 213.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300119-1	SPG-100_10 mcg	10 mcg	$261		Add to Cart
BHP21300119-2	SPG-100_10 mcg	5x10 mcg	$1030		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.