JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

human GDNF-Biotin

SKU : BHP21300047

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	G-240-B, G-240-B_10 mcg, G-240-B_5 mcg
Description	human GDNF-Biotin (#G-240-B) is a highly pure, recombinant, and biologically active conjugated protein. Benefits of human GDNF-Biotin: ? Localization and distribution ? Live cell imaging ? Single cell detection ? Indirect flow cytometry We gladly take on collaboration projects. Please Contact Us.
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (5 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Background	Glial-derived neurotrophic factor (GDNF) is a member of the TGF-beta superfamily. GDNF signals through a multi-component receptor system, composed of a RET proto-oncogene and one of the four alpha1-alpha4 receptors.1 GDNF promotes survival of various neuronal cells, including motoneurons,2,3 Purkinje cells and sympathetic neurons.4 In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity DA uptake.5 Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells,6 neurons, pinealocytes, and skeletal muscle cells.7 In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from cell death.8 GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons.9,10
Biological Activity	GDNF enhances survival and differentiation of dopaminergic neurons. It is also a potent survival factor for motor neurons1-3.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	30.8 kDa (dimer)
Source	Modified recombinant protein, E. coli
Concentration	1 nM 0.1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	LC-Biotin

Synonyms	Glial Cell Line-Derived Neurotrophic Factor
Gene Id	GFRA1, RET
Sequence	SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI-OH
Target	GFRA1 (GDNFR-Alpha-1), RET Receptor Tyrosine Kinase

Country Of Origin	Israel/IL
Storage	Storage After Reconstitution: Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.

Applications	Western blot, Live cell imaging, Immunofluorescence, Fluorescence staining, Indirect flow cytometry

Reference	Airaksinen, M.S. Saarma, M. (2002) Nat. Rev. Neurosci. 3, 383. Henderson, C.E. et al. (1994) Science 266, 1062. Houenou, L.J. et al. (1996) Cell. Tissue Res. 286, 219. Kobayashi, M. and Matsuoka, I. (2000) Neuroreport 11, 2541. Tomac, A. et al. (1995) Nature 373, 335. Zhou, F.Q. et al. (2003) Cell 113, 814. Lin, L.F. et al. (1993) Science 260, 1130. Matheson, C.R. et al. (1997) Neuroreport 8, 1739. Brundin, P. (2002) Brain 125, 2149. Grondin, R. and Gash, D.M. (1998) J. Neurol. 245, P35. Lin, L.F. et al. (1993) Science 260, 1130. Lin, L.F. et al. (1994) J. Neurochem. 63, 758. Henderson, C.E. et al. (1995) Science 266, 1062.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300047-1	G-240-B_10 mcg	10 mcg	$821		Add to Cart
BHP21300047-2	G-240-B_5 mcg	5 mcg	$480		Add to Cart
BHP21300047-3	G-240-B_10 mcg	2x10 mcg	$1270		Add to Cart
BHP21300047-4	G-240-B_10 mcg	5x10 mcg	$2439		Add to Cart
BHP21300047-5	G-240-B_10 mcg	10x10 mcg	$3345		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.