JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

human GALP (3-32)

SKU : BHP21300058

A Non-Selective and Potent Agonist of Galanin Receptors

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	GPG-250, GPG-250_1 mg, GPG-250_10 mg, GPG-250_2.5 mg, GPG-250_5 mg
Description	A Non-Selective and Potent Agonist of Galanin Receptors
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C137H213N43O38S1
Background	Human GALP (3-32) fragment is a human galanin-like peptide that acts as a non-selective and potent galanin receptor agonist. Human GALP consists of 60 amino acid with a potential proteolytic cleavage site between two basic amino acids in position 33.Human GALP (3-32) shares amino acids in position 9-21 with the first 13 amino acids of galanin, an essential sequence for activating galanin receptors1,2. Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3.Human GALP (3-32) is at least as potent as full length GALP. Studies suggest that GALP (3-32) fragment can represent the strongest mediator of biological GALP activity. GALP (3-32) can be used as a useful tool for studding the affinity of GALP to galanin receptors and to search for specific GALP receptors1,2. Human GALP (3-32) displays highest affinity to GalR3 with an IC50 value of 10 nM, followed by GalR2 with IC50 of 28 nM and GalR1 with IC50 of 77 nM1.
Biological Activity	Human GALP (3-32) is a Galanin receptor agonist1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3102 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Concentration	1 - 50 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: No
UNSPSC Code	12352202
Lead Time	1-2 Business Days

Synonyms	Galanin-like peptide (3-32)
Gene Id	GALR1, GALR2, GALR3
Sequence	AHRGRGGWTLNSAGYLLGPVLHLPQMGDQ-OH
Target	Galanin receptors

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Aequorin functional assay, Calcium imaging assay

Reference	Lang, R. et al. (2005) Neuropeptides 39, 179. Schmidhuber, S.M. et al. (2007) J. Invest. Dermatol. 127, 716. Lang, R. et al. (2005) Neuropeptides 39, 179.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300058-1	GPG-250_1 mg	1 mg	$202		Add to Cart
BHP21300058-2	GPG-250_10 mg	10 mg	$680		Add to Cart
BHP21300058-3	GPG-250_2.5 mg	2.5 mg	$337		Add to Cart
BHP21300058-4	GPG-250_5 mg	5 mg	$470		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.