JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Hj2a Toxin

SKU : BHP21300228

A Potent Activator of Nav1.1, Nav1.4, Nav1.5, Nav1.6 and Nav1.7 Channels.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STH-555, STH-555_0.1 mg, STH-555_0.5 mg, STH-555_1 mg, STH-555_50 mcg
Description	A Potent Activator of Nav1.1, Nav1.4, Nav1.5, Nav1.6 and Nav1.7 Channels.
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C304H458N90O93S8
Background	delta-buthitoxin-Hj2a (Hj2a) is a peptidyl toxin originally isolated from the venom of the scorpion, Hottentotta jayakari. Hj2a acts as a voltage-gated sodium (Nav) 1.1 channel activator, but it also harbors promiscuous activity towards multiple human NaV channel subtypes. Hj2a is unique in that it exhibits a dual alpha/beta mode of action by modifying both the inactivation (alpha-toxin activity) and activation (beta-toxin activity) properties of the NaV1.1 channel1.NaV channels are involved in a wide array of physiological processes and play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. In particular, the NaV1.1 channel is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in the NaV1.1 channel were shown to be associated with Dravet syndrome (DS), a severe form of pediatric epilepsy. Selective modulators of the NaV1.1 channel can be useful therapeutics for DS treatment since they target the underlying molecular deficit. The unusual dual mode of action of Hj2a provides an alternative approach for the development of selective NaV1.1 channel modulators for the treatment of DS1,2.
Biological Activity	Hj2a is an agonist of NaV1.1 which presents dual alpha/beta activity by modifying both the activation and inactivation properties of the channel1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	7118 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	P0DQN9
Concentration	20 - 500 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys12-Cys63, Cys16-Cys36, Cys22-Cys46 and Cys26-Cys48 Arg64 - C-terminal amidation
Origin	Hottentotta judaicus (Black scorpion) (Buthotus judaicus)

Synonyms	Delta-buthitoxin-Hj2a, Delta-BUTX-Hj2a
Gene Id	SCN1A,SCN4A,SCN5A,SCN8A,SCN9A
Sequence	GRDAYIADDKNCVYTCAKNSYCNNECTKNGAESGYCQWLGKYGNGCWCKNLPDKVPIRIPGPCR-NH2
Target	NaV1.1, Voltage-gated Na+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Chow, C.Y. et al. (2020) ACS Pharmacol. Transl. Sci. 3, 119. Depienne, C. et al. (2008) J. Med. Genet. 46, 183.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300228-1	STH-555_0.1 mg	0.1 mg	$1062		Add to Cart
BHP21300228-2	STH-555_0.5 mg	0.5 mg	$3724		Add to Cart
BHP21300228-3	STH-555_1 mg	1 mg	$5935		Add to Cart
BHP21300228-4	STH-555_50 mcg	50 mcg	$665		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.