JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Hj1a Toxin

SKU : BHP21300226

An Activator of NaV1.1 Channel

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STH-450, STH-450_0.1 mg, STH-450_0.5 mg, STH-450_1 mg, STH-450_10 mg, STH-450_5 mg
Description	An Activator of NaV1.1 Channel
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C326H482N92O96S8
Background	Hj1a is a peptide toxin originally isolated from the Hottentotta jayakari scorpion venoM Hj1a acts as a potent NaV1.1 channel activator. Hj1a is unique in that it presents a dual alpha/beta activity by modifying both the activation and inactivation properties of the channel1.NaV1.1 is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in NaV1.1 channel were shown to be related to Dravet syndrome (DS), a severe form of pediatric epilepsy. NaV1.1 selective modulators can be useful therapeutics for treatment of DS as they target the underlying molecular deficit2.
Biological Activity	Hj1a Toxin is an activator of NaV1.1 which presents dual alpha/beta activity by modifying both the activation and inactivation properties of the channel1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	7482.5 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	P0DQN8
Concentration	1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys14-Cys65, Cys18-Cys38, Cys24-Cys48 and Cys28-Cys50
Origin	Hottentotta judaicus (Black scorpion) (Buthotus judaicus)

Synonyms	delta-buthitoxin-Hj1a, Delta-buthitoxin-Hj1a
Gene Id	SCN1A,SCN4A,SCN5A,SCN8A
Sequence	EEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECKWFTSSGNACWCVKLPKSEPIKVPGKCH-OH
Target	Nav1.1 channels

Country Of Origin	Israel/IL
Purity	>95% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Chow, C.Y. et al. (2020) ACS Pharmacol. Transl. Sci. 3, 119. Depienne, C. et al. (2008) J. Med. Genet. 46, 183.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300226-1	STH-450_0.1 mg	0.1 mg	$406		Add to Cart
BHP21300226-2	STH-450_0.5 mg	0.5 mg	$958		Add to Cart
BHP21300226-3	STH-450_1 mg	1 mg	$1536		Add to Cart
BHP21300226-4	STH-450_10 mg	10 mg	$6438		Add to Cart
BHP21300226-5	STH-450_5 mg	5 mg	$4024		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.