JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Hd1a Toxin

SKU : BHP21300219

A Selective Blocker of NaV1.7 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STH-200, STH-200_0.1 mg, STH-200_0.5 mg, STH-200_1 mg, STH-200_5 mg
Description	A Selective Blocker of NaV1.7 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C160H246N46O51S6
Background	Hd1a Toxin, also called u-TRTX-Hd1a, is a peptide toxin that acts as a selective and potent blocker of voltage-gated NaV1.7 channels.The Hd1a peptide is a member of the NaSpTx family 1 of spider venoms, originating from the Haplopelma doriae spider. The toxin inhibits human NaV1.7 by interacting with the S3b-S4 paddle motif in channel domain II. Hd1a structure contains an inhibitor cystine knot motif that is likely to confer high levels of chemical, thermal and biological stability1.Human NaV1.7 shows properties as an analgesic target. Loss-of-function mutations in the SNC9A gene that encodes human NaV1.7 result in congenital indifference to all forms of pain. Thus, inhibitors of hNaV1.7 including Hd1a Toxin are likely to be useful analgesics for treating a range of pain conditions1,2.
Biological Activity	Hd1a is a selective and potent blocker of voltage-gated NaV1.7 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3822.4 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	A0A0J9X1W9
Concentration	500 nM - 1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31
Origin	Cyriopagopus doriae (Tarantula spider) (Haplopelma doriae)

Synonyms	u-TRTX-Hd1a
Gene Id	SCN1A,SCN9A
Sequence	ACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL-OH
Target	NaV1.7 channel

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Klint, J.K. et al. (2015) Br. J. Pharmacol. 172, 2445. Laedermann, C.J. et al. (2015) Front. Pharmacol. 6, 263. Klint, J.K. et al. (2015) Br. J. Pharmacol. 172, 2445.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300219-1	STH-200_0.1 mg	0.1 mg	$254		Add to Cart
BHP21300219-2	STH-200_0.5 mg	0.5 mg	$747		Add to Cart
BHP21300219-3	STH-200_1 mg	1 mg	$1309		Add to Cart
BHP21300219-4	STH-200_5 mg	5 mg	$4552		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.