JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Guangxitoxin-1E

SKU : BHP21300206

A Potent Gating Modifier of KV2.1, KV2.2 and KV4.3 K+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STG-200, STG-200_0.1 mg, STG-200_0.5 mg, STG-200_1 mg, STG-200_10 mg, STG-200_5 mg, STG-200_50 mcg
Description	A Potent Gating Modifier of KV2.1, KV2.2 and KV4.3 K+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C178H248N44O45S7
Background	Guangxitoxin-1E is a 36 amino acid peptidyl toxin isolated from the Chilobrachys jingzhao (Chinese earth tiger) tarantula venom and belongs to the huwentoxin-1 family. Guangxitoxin-1E is a gating modifier of KV2.1 (KCNB1, IC50 of 1 nM), KV2.2 (KCNB2, IC50 of 3 nM) and KV4.3 (KCND3, IC50 of 50 nM) channels1. In pancreatic beta cells, it enhances glucose-stimulated insulin secretion by broadening the cell action potential and enhancing calcium oscillations1,2. The physiological modulation of KV2.1 channels during glucose-induced insulin secretion is MgATP-mediated3,4. No significant effect was found on KV1.2 (KCNA2), KV1.3 (KCNA3), KV1.5 (KCNA5), KV3.2 (KCNC2), CaV1.2 (CACNA1C), CaV2.2 (CACNA1B), NaV1.5 (SCN5A), NaV1.7 (SCN9A) or NaV1.8 (SCN10A) channels1,2.
Biological Activity	Guangxitoxin-1E is a gating modifier of KV2.1 (KCNB1, IC50 of 1 nM), KV2.2 (KCNB2, IC50 of 3 nM) and KV4.3 (KCND3, IC50 of 10-20 fold higher concentration) channels. In pancreatic beta cells it enhances glucose-stimulated insulin secretion by broadening the cell action potential and enhancing calcium oscillations1,2. The physiological modulation of KV2.1 channels during glucose-induced insulin secretion is MgATP-mediated3.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3948.7 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P84835
Concentration	1 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Cited Application: Electrophysiology Is Toxin: Yes
Cas Number	1233152-82-3
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Presumed disulfide bonds between: Cys4-Cys19, Cys11-Cys24 and Cys18-Cys31 (disulfide bonds undetermined).
Origin	Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Synonyms	GxTx-1E, kappa-Theraphotoxin-Pg1a, kappa-TRTX-Pg1a, Guangxitoxin 1E
Gene Id	KCNB1,KCNB2 ,KCND3
Sequence	EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP-OH
Target	Various KV channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Herrington, J. et al. (2006) Diabetes 55, 1034. Herrington, J. (2007) Toxicon 49, 231. Yoshida, M. et al. (2010) Biochem. Biophys. Res. Commun. 396, 304. Yoshida M. et al. (2009) FEBS Lett. 583, 2225. Herrington, J. et al. (2006) Diabetes 55, 1034. Herrington, J. (2007) Toxicon 49, 231. Yoshida, M. et al. (2010) Biochem. Biophys. Res. Commun. 396, 304.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300206-1	STG-200_0.1 mg	0.1 mg	$185		Add to Cart
BHP21300206-2	STG-200_0.5 mg	0.5 mg	$737		Add to Cart
BHP21300206-3	STG-200_1 mg	1 mg	$1179		Add to Cart
BHP21300206-4	STG-200_10 mg	10 mg	$5773		Add to Cart
BHP21300206-5	STG-200_5 mg	5 mg	$4124		Add to Cart
BHP21300206-6	STG-200_50 mcg	50 mcg	$93		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.