JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

GsAF-II

SKU : BHP21300209

A Blocker of TTX-Sensitive NaV and KV11.1 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STG-350, STG-350_0.1 mg, STG-350_0.25 mg, STG-350_0.5 mg, STG-350_1 mg, STG-350_10 mg, STG-350_5 mg
Description	A Blocker of TTX-Sensitive NaV and KV11.1 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C176H261N47O45S7
Background	The tetrodotoxin (TTX)-sensitive Na+ channels are differentially distributed in the central and peripheral nervous system, in skeletal muscle, and in cardiac muscle1. Several venom-derived peptides are known to modify the gating properties of ion channels, and the study of their mechanisms of action is expected to contribute to the elucidation of the molecular motions associated with channel gating2.Tarantula venoms are a library of interesting compounds, some of which are exquisite modulators of many types of ion channels. A large number of spider toxins have been demonstrated to modulate NaV channels3.GsAF-II (also termed kappa-theraphotoxin-Gr2c) is a peptidyl toxin originally isolated from the venom of Grammostola rosea spider. This toxin has antinociceptive and antiarrhythmic effects in mammals. The peptide is reported to block the following voltage-gated Na+ channels: NaV1.1, NaV1.2, NaV1.3, NaV1.4, NaV1.6 and NaV1.7 with IC50 values of 5.7, 12, 24, 4, 6.6 and 1.3 uM, respectively. This peptide also blocks hERG1 with an IC50 value of 4.7 uM4.
Biological Activity	GsAF-II is a blocker of TTX-sensitive NaV and KV11.1 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3979.8 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P61409
Concentration	1 - 24 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21 and Cys15-Cys25
Origin	Grammostola rosea (Chilean rose tarantula) (Grammostola spatulata)

Synonyms	Kappa-theraphotoxin-Gr2c, kappa-TRTX-Gr2c, GsAF II, GsAFII, Mechanotoxin-alpha
Gene Id	CACNA1C,KCNH2,SCN1A,SCN2A,SCN4A,SCN8A,SCN9A
Sequence	YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW-OH
Target	TTX-sensitive NaV, KV11.1 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Catterall W.A. et al. (2005) Pharmacol. Rev. 57, 397. Garcia M.L. and Possani L.D. (2007) Toxicon 49, 123. Escoubas P. et al. (2004) Toxicon 43, 555. Redaelli, E. et al. (2010) J. Biol. Chem. 285, 4130. Redaelli, E. et al. (2010) J. Biol. Chem. 285, 4130.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300209-1	STG-350_0.1 mg	0.1 mg	$154		Add to Cart
BHP21300209-2	STG-350_0.25 mg	0.25 mg	$384		Add to Cart
BHP21300209-3	STG-350_0.5 mg	0.5 mg	$690		Add to Cart
BHP21300209-4	STG-350_1 mg	1 g	$1100		Add to Cart
BHP21300209-5	STG-350_10 mg	10 mg	$7014		Add to Cart
BHP21300209-6	STG-350_5 mg	5 mg	$4384		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.