JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Fasciculin-I

SKU : BHP21300044

A Potent and Reversible Blocker of Acetylcholinesterase

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	F-650, F-650_70 mcg
Description	A Potent and Reversible Blocker of Acetylcholinesterase
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C281H441N87O90S10
Background	Fasciculin-I is a 61 amino acid peptidyl toxin with four disulfide bonds, isolated from the Eastern green mamba (Dendroaspis angusticeps) venom. Fasciculin-I belongs to the three finger toxin family, structurally similar to the short alpha-neurotoxins and cardiotoxins1.Fasciculin-I was shown to be a selective, potent, and reversible blocker of the mammalian acetylcholinesterase (AChE) at picomolar concentrations1. Injection of Fasciculin-I to mice causes severe generalized and long-lasting twitch (fasciculation) due to its ability to accumulate acetylcholine at the neuromuscular junction2.
Biological Activity	Fasciculin-I selectively and potently binds and inhibits acetylcholinesterase.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6799 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Natural protein
Accession Number	P0C1Y9
Concentration	1 - 10 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys59
Origin	Dendroaspis angusticeps (Eastern green mamba).

Synonyms	Fasciculin-1, Fas-1, Fas1, FAS-I, Toxin TA1
Gene Id	ACHE
Sequence	TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY-OH
Target	Acetylcholinesterase (AChE)

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Acetylcholinesterase (AChE) activity

Reference	Anglister, L. et al. (1978) J. Mol. Biol. 125, 293. Ellman, G.L. et al. (1961) Biochem. Pharmacol. 7, 88. Karlsson, E. et al. (1986) Pharmacol. Ther. 30, 259. Ellman, G.L. et al. (1961) Biochem. Pharmacol. 7, 88. Anglister, L. et al. (1978) J. Mol. Biol. 125, 293.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300044-1	F-650_70 mcg	70 mcg	$598		Add to Cart
BHP21300044-2	F-650_70 mcg	5x70 mcg	$2378		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.