JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

DkTx-K2

SKU : BHP21300200

A Reversible Activator of TRPV1 Channel

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STD-020, STD-020_0.1 mg, STD-020_0.5 mg, STD-020_1 mg, STD-020_5 mg
Description	A Reversible Activator of TRPV1 Channel
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C159H233N43O46S6
Background	Double-knot toxin-K2 (DkTx-K2) is one of the two inhibitory cysteine-knot (ICK) lobes that are the receptor-binding subunits of the full-length DkTx toxin (1,2). DkTx, a peptide toxin originally isolated from the venom of the Chinese bird spider Cyriopagopus schmidti (formerly known as Ornithoctonus huwena), selectively and irreversibly activates the transient receptor potential vanilloid 1 (TRPV1) channel by targeting the outer pore domain (1). The two ICK motifs that comprise DkTx (K1 and K2) are highly homologous yet differ in their potency, affinity, and binding orientation to the TRPV1 channel.Full-length DkTx partitions into the cellular membrane and binds bivalently to TRPV1, triggering long-lasting channel activation. In contrast, its monovalent single knots partition into the membrane poorly and activate TRPV1 in a rapidly reversible manner (3-6). DkTx-K2 is a more effective activator of TRPV1 than K1, since K2 binds to the outer channel as part of a protein-protein interface, while K1 initiates membrane interaction. DkTx-K2 therefore binds TRPV1 with higher affinity than K1 (1-3), which makes it a more flexible and specific research tool than native DkTx or capsaicin.One of the most versatile pain receptors, TRPV1, is expressed in nociceptors and plays important roles in the transduction of noxious stimuli and thermosensation. In addition, TRPV1 is widely expressed in non-neuronal cells and has been shown to play an important role in the immune systeM As a receptor for multiple injurious stimuli, TRPV1 has emerged as a new and promising target for developing analgesic and anti-inflammatory drugs (7,8).
Biological Activity	Reversibly activates TRPV1 channel.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	3675.3 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0CH43
Concentration	2 - 10 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys29
Origin	Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti)

Synonyms	Tau-theraphotoxin-Hs1a-K2, Tau-TRTX-Hs1a-K2
Gene Id	TRPV1
Sequence	NCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR-OH
Target	TRPV1 channel

Country Of Origin	Israel/IL
Purity	>96% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	C. J. Bohlen et al., Cell. 141, 834845 (2010), doi:10.1016/j.cell.2010.03.052 C. Bae et al., PLoS ONE. 7, e51516 (2012). doi:10.1371/journal.pone.0051516 C. Bae et al., eLife. 5, e11273 (2016), doi:10.7554/eLife.11273 E. Cao, M. Liao, Y. Cheng, D. Julius, Nature. 504, 113118 (2013) doi:10.1038/nature12823 Y. Gao, E. Cao, D. Julius, Y. Cheng, Nature. 534, 347351 (2016), doi:10.1038/nature17964 Y. Singh et al., Journal of Biological Chemistry. 299, 104903 (2023), doi:10.1016/j.jbc.2023.104903 T. Xiao, M. Sun, J. Kang, C. Zhao, Front. Immunol. 13, 870952 (2022), doi:10.3389/fimmu.2022.870952 J. Zeng et al., Heliyon. 10, e24153 (2024), doi:10.1016/j.heliyon.2024.e24153 Bohlen, C. J. et al. (2010) Cell, 141, 834. Bae, C. et al. (2012) PLoS One, 7, e51516.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300200-1	STD-020_0.1 mg	0.1 mg	$245		Add to Cart
BHP21300200-2	STD-020_0.5 mg	0.5 mg	$854		Add to Cart
BHP21300200-3	STD-020_1 mg	1 mg	$1197		Add to Cart
BHP21300200-4	STD-020_5 mg	5 mg	$3578		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.