JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Charybdotoxin

SKU : BHP21300162

A Blocker of KV1.2, KV1.3 and KCa1.1 K+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STC-325, STC-325_0.1 mg, STC-325_0.25 mg, STC-325_0.5 mg, STC-325_1 mg, STC-325_10 mg, STC-325_5 mg, STC-325_50 mcg
Description	A Blocker of KV1.2, KV1.3 and KCa1.1 K+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C176H277N57O55S7
Background	Charybdotoxin was originally isolated from the venom of the Israeli scorpion Leiurus quinquestriatus hebraeus1. Charybdotoxin blocks KCa1.1 (large conductance Ca2+-activated K+, Slo) channels in nM concentrations2 as well as KV1.2 (Kd, 14 nM) and KV1.3 (Kd, 2.6 nM) channels3. However, experiments with cloned KCa1.1 channels demonstrate the strong effect of the slobeta subunits on the potency of block by Charybdotoxin (see for example 4).
Biological Activity	Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4296 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P13487
Concentration	10 -100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	95751-30-7
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35 Z= Pyrrolidone carboxylic acid (Glp)
Origin	Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Synonyms	K+ channel toxin alpha-KTx 1.1, ChTX, ChTX-Lq1, ChTx-a
Gene Id	KCNMA1, KCNA2, KCNA3, KCNA6
Sequence	ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS-OH
Target	KCa1.1, KV1.2, KV1.3 K+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Gimenez-Gallego, G. et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85, 3329. Miller, C. et al. (1985) Nature 313, 316. Grissmer, S. et al. (1994) Mol. Pharmacol. 45, 1227. Meera, P. et al. (2000) Proc. Natl. Acad. Sci. U.S.A. 97, 5562. Sugg, E.E. et al. (1990) J. Biol. Chem. 265, 18745. Gimenez-Gallego, G. et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85, 3329.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300162-1	STC-325_0.1 mg	0.1 mg	$152		Add to Cart
BHP21300162-2	STC-325_0.25 mg	0.25 mg	$295		Add to Cart
BHP21300162-3	STC-325_0.5 mg	0.5 mg	$483		Add to Cart
BHP21300162-4	STC-325_1 mg	1 mg	$676		Add to Cart
BHP21300162-5	STC-325_10 mg	10 mg	$4324		Add to Cart
BHP21300162-6	STC-325_5 mg	5 mg	$2703		Add to Cart
BHP21300162-7	STC-325_50 mcg	50 mcg	$77		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.