JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Ceratotoxin-2

SKU : BHP21300147

A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STC-100, STC-100_0.1 mg, STC-100_0.5 mg, STC-100_1 mg, STC-100_10 mg, STC-100_5 mg, STC-100_50 mcg
Description	A Potent Blocker of Central Nervous System Voltage-Gated Na+ Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C177H260N52O49S6
Background	Ceratotoxin-2 was originally isolated from the Ceratogyrus cornuatus (Ceratogyrus marshalli, Straighthorned baboon tarantula) venom1.Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against NaV1.2 channel than the other NaV channel subtypes1.
Biological Activity	Ceratotoxin-2 modulates different voltage-gated Na+ channel subtypes from the central nervous system (NaV1.1-NaV1.5 and NaV1.8) by shifting the voltage dependence of channel activation to more depolarized potentials and by blocking the inward component of the Na+ current. It is significantly more potent against the NaV1.2 channel than other NaV channel subtypes1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4092.7 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P84508
Concentration	5 nM - 2 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 Leu33 - C-terminal amidation
Origin	Ceratogyrus marshalli (Straighthorned baboon tarantula) (Ceratogyrus cornuatus)

Synonyms	beta-Theraphotoxin-Cm1b, beta-TRTX-Cm1b, CcoTx2
Gene Id	SCN1A, SCN2A, SCN3A, SCN4A, SCN8A, SCN9A, CACNA1B
Sequence	DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL-NH2
Target	NaV channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419. Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300147-1	STC-100_0.1 mg	0.1 mg	$343		Add to Cart
BHP21300147-2	STC-100_0.5 mg	0.5 mg	$1026		Add to Cart
BHP21300147-3	STC-100_1 mg	1 mg	$1435		Add to Cart
BHP21300147-4	STC-100_10 mg	10 mg	$6018		Add to Cart
BHP21300147-5	STC-100_5 mg	5 mg	$4294		Add to Cart
BHP21300147-6	STC-100_50 mcg	50 mcg	$266		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.