JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Ceratotoxin-1

SKU : BHP21300184

A Blocker of NaV channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STC-680, STC-680_0.1 mg, STC-680_0.5 mg, STC-680_1 mg, STC-680_10 mg, STC-680_5 mg, STC-680_50 mcg
Description	A Blocker of NaV channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C172H256N52O50S6
Background	There are currently nine types of voltage-gated Na+ (NaV) channels defined and characterized. The channels are responsible for propagation and the creation of action potential in excitable cells1. The channel is comprised of the main alpha subunit and the beta auxiliary subunits. Although the alpha subunit is sufficient for channel expression it is the beta subunit that modifies the kinetics and voltage dependency of the channel. The alpha subunits are organized in four homologous domains (I-IV) each containing six transmembrane alpha helices (S1-S6)2.Ceratotoxin-1 (beta-theraphotoxin-Cm1a, beta-TRTX-Cm1a, CcoTx1) is a NaV channel blocker. This peptide toxin was originally isolated from the spider species Ceratogyrus marshalli (Straighthorned baboon tarantula). The toxin binds to all NaV channels in the central nervous system apart from NaV1.33. Mice injected with 500 pmol of Ceratotoxin-1 exhibited symptoms of neurological toxicity in the form of difficulty of standing, breathing reduction and flaccid paralysis. Ceratotoxin-1 also decreases Na+ influx in NaV1.1, NaV1.2, NaV1.4. It is especially selective for NaV1.2 with an IC50 value of 3±1 nM3.
Biological Activity	Ceratotoxin-1 is a NaV channel blocker1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4044.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P84507
Concentration	1 - 900 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys22 and Cys16-Cys29 Leu33 - C-terminal amidation
Origin	Ceratogyrus marshalli (Straighthorned baboon tarantula) (Ceratogyrus cornuatus)

Synonyms	beta-Theraphotoxin-Cm1a, beta-TRTX-Cm1a, CcoTx1
Gene Id	CACNA1B,SCN1A,SCN2A,SCN4A,SCN5A,SCN9A
Sequence	DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYDL-NH2
Target	NaV channels

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Catterall, W.A. (2000) Neuron 26, 13. Catterall, W.A. et al. (2005) Pharmacol. Rev. 57, 39. Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419. Bosmans, F. et al. (2006) Mol. Pharmacol. 69, 419.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300184-1	STC-680_0.1 mg	0.1 mg	$364		Add to Cart
BHP21300184-2	STC-680_0.5 mg	0.5 mg	$1296		Add to Cart
BHP21300184-3	STC-680_1 mg	1 mg	$1879		Add to Cart
BHP21300184-4	STC-680_10 mg	10 mg	$7642		Add to Cart
BHP21300184-5	STC-680_5 mg	5 mg	$5634		Add to Cart
BHP21300184-6	STC-680_50 mcg	50 mcg	$266		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.