JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Cd1a Toxin

SKU : BHP21300158

Potent blocker of Nav1.7 channel and modest blocker of Cav2.2

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STC-260, STC-260_0.1 mg, STC-260_0.5 mg, STC-260_1 mg, STC-260_5 mg, STC-260_50 mcg
Description	Potent blocker of Nav1.7 channel and modest blocker of Cav2.2
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C171H254N52O50S6
Background	Cd1a Toxin (beta-theraphotoxin-Cd1a) is a spider toxin, isolated from the venom of the African rear-horned baboon tarantula Ceratogyrus darlingi, a spider species that is mostly native to southern Africa1.Cd1a Toxin was shown to be a potent blocker of Nav1.7 channel and has a modest activity on CaV2.2 channels. Cd1a Toxin reversed spontaneous pain behaviours induced in mice by activation of NaV1.7, demonstrating its analgesic potential1. Physiological and pharmacological studies have demonstrated that Cav channels, including CaV2.2 and a number of NaV channels, including NaV1.7, are involved in nociceptive signaling, playing a critical role in the development of chronic pain associated with tissue and nerve injury1.Cd1a Toxin belongs to NaSpTx family 1, a class of promiscuous toxins that can modulate a range of ion channels, including NaV, CaV, KV, mechanosensitive and proton-gated ion channels. The primary structure of Cd1a strongly suggests that it will fold into an ICK motif that is expected to provide a high level of chemical, thermal and biological stability1.
Biological Activity	Cd1a is a potent blocker of Nav1.7 channels and has a modest activity on CaV2.2 channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4030.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0DL84
Concentration	100 - 500 nM (Nav 1.7)
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys2-Cys17, Cys9-Cys22 and Cys16-Cys29 Leu33 - C-terminal amidation
Origin	Ceratogyrus darlingi (Rear horned baboon tarantula)

Synonyms	Beta-theraphotoxin-Cd1a, beta-theraphotoxin-Cd1a, beta-TRTX-Cd1a
Gene Id	CACNA1B,SCN10A,SCN1A,SCN2A,SCN9A
Sequence	DCLGWFKSCDPKNDKCCKNYSCSRRDRWCKYDL-NH2
Target	Nav1.7 and Cav2.2 blocker

Country Of Origin	Israel/IL
Purity	>95% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Sousa, S.R. et al. (2019) PlosONE 12(9), e0182848.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300158-1	STC-260_0.1 mg	0.1 mg	$465		Add to Cart
BHP21300158-2	STC-260_0.5 mg	0.5 mg	$1258		Add to Cart
BHP21300158-3	STC-260_1 mg	1 mg	$2018		Add to Cart
BHP21300158-4	STC-260_5 mg	5 mg	$5027		Add to Cart
BHP21300158-5	STC-260_50 mcg	50 mcg	$292		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.