JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Calcicludine

SKU : BHP21300113

A Blocker of Neuronal L-Type CaV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	SPC-650, SPC-650_0.25 mg, SPC-650_0.5 mg, SPC-650_1 mg, SPC-650_10 mg, SPC-650_5 mg, SPC-650_70 mcg
Description	A Blocker of Neuronal L-Type CaV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C321H476N86O78S6
Background	Calcicludine is a natural peptide isolated from the Dendroaspis angusticeps green mamba venom by a modification to the procedure of Schweitz et al.1 and purified to homogenity.Calcicludine was shown to be a specific neuronal L-type CaV channel blocker and was shown to inhibit other neuronal HVA CaV channels (N- and P-type) as well.1 1 uM Calcicludine had no effect on skeletal muscle CaV channels (CaV1.1) as well as on T-type (CaV3) channels in heart and neurons.1 Calcicludine was tested to confirm its ability to block spontaneous or K+-induced contraction of cardiac cells.1 It blocked CaV1.2 cloned channels with an IC50 of 88 nM and had very little effect on CaV2 family channels.2 In addition, the block was irreversible upon wash and never complete but reached a maximum of 58%.
Biological Activity	Calcicludine is a potent and specific antagonist of neuronal L-type CaV channels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6980 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	P81658
Concentration	500 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	178037-96-2
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53
Origin	Dendroaspis angusticeps (Eastern green mamba)

Synonyms	CAC
Gene Id	CACNA1A,CACNA1B,CACNA1C,CACNA1D,CACNA1F,CACNA1S
Sequence	WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK-OH
Target	L-type Ca2+ channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Schweitz, H. et al. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 878. Stotz, S.C. et al. (2000) J. Membr. Biol. 174, 157. Schweitz, H. et al. (1994) Proc. Natl. Acad. Sci. U.S.A. 91, 878.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300113-1	SPC-650_0.25 mg	0.25 mg	$460		Add to Cart
BHP21300113-2	SPC-650_0.5 mg	0.5 mg	$732		Add to Cart
BHP21300113-3	SPC-650_1 mg	1 mg	$1153		Add to Cart
BHP21300113-4	SPC-650_10 mg	10 mg	$6447		Add to Cart
BHP21300113-5	SPC-650_5 mg	5 mg	$4030		Add to Cart
BHP21300113-6	SPC-650_70 mcg	70 mcg	$192		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.