JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

BomoTx Toxin

SKU : BHP21300086

A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	NTB-200, NTB-200_0.14 mg, NTB-200_35 mcg, NTB-200_70 mcg
Description	A Somatosensory, Pain Inducing Neuron Stimulator, Indirect P2X2/P2X3 Receptor Agonist
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C598H942N166O181S15
Background	BomoTx belongs to a group of secreted phospholipase A2 (sPLA2)-like protein toxins originally isolated from the Brazilian lancehead pit viper (Bothrops moojeni). This toxin contains a conserved PLA2 fold but lacks enzymatic activity. BomoTx is mostly related to Lys49 myotoxins found in snake species within the Crotalinae subfamily1.BomoTx functions by activating a subpopulation of somatosensory neurons that contribute to pain sensation. BomoTx excites these neurons by stimulating the release of cellular ATP through a mechanism involving pannexin hemichannels resulting in activation of P2X2 and P2X3 purinergic receptors. Injection of BomoTx to mouse hind paw causes non-neurogenic inflammatory pain, thermal hyperalgesia, and mechanical allodynia.P2X receptors are cationic trimeric channel complexes that function as ATP-gated calcium-permeable channels and are attractive therapeutic targets. This family contains seven receptor subtypes: P2X1-P2X72.
Biological Activity	BomoTx Toxin excites sensory neurons via ATP release and consequent activation of P2X2 and/or P2X3 receptors.
Formulation	Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Molecular Weight	13834 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Natural protein
Accession Number	A0A1S5XW05
Concentration	1 uM
Form	Lyophilized
Notes	Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	The exact location of the disulfide bridges is currently unknown.
Origin	Bothrops moojeni (Brazilian lancehead pit viper)

Synonyms	BomoToxin, Bomo Toxin, Myotoxin, Phospholipase A2 like protein, PLA2-like toxin
Gene Id	P2RX2,P2RX3
Sequence	SLVELGKMILQETGKNPVTSYGAYGCNCGVLGRGKPKDATDRCCYVHKCCYKKLTDCNPKKDRYSYSWKDKTIVCGENNSCLKELCECDKAVAICLRENLDTYNKKYKNNYLKPFCKKADPC
Target	P2X2/P2X3 receptors

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Zhang, C. et al. (2017) Proc. Natl. Acad. Sci. U.S.A. 114, e2524. Pasqualetto, G. et al. (2018) Front. Pharmacol. 9, 58.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300086-1	NTB-200_0.14 mg	0.14 mg	$730		Add to Cart
BHP21300086-2	NTB-200_35 mcg	35 mcg	$287		Add to Cart
BHP21300086-3	NTB-200_70 mcg	70 mcg	$459		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.