JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

BmKI Toxin

SKU : BHP21300138

An Activator of NaV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STB-100, STB-100_0.1 mg, STB-100_0.5 mg, STB-100_1 mg, STB-100_5 mg, STB-100_50 mcg
Description	An Activator of NaV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C313H467N91O91S8
Background	BmKI Toxin (Alpha-like toxin BmK-M1) is a peptide toxin originally isolated from Mesobuthus martensii scorpion venoM It is a positive modulator of voltage-gated Na+ channels by inhibiting the inactivation of activated NaV channels. BmKI Toxin activity was demonstrated on NaV1.4, NaV1.5, NaV1.6 channels.The structure of BmKI Toxin includes a motif consisting of one or two short segments of alpha-helix and a triple-stranded beta-sheet, connected by variable regions forming loops1,2.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. These channels responsible for propagating action potentials in excitable cells and are important therapeutic targets for numerous pathophysiological conditions such as cardiac arrhythmia, and epilepsy3.
Biological Activity	BmKI Toxin inhibits the inactivation of activated voltage-gated Na+ channels.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	7217 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P45697
Concentration	500 - 1000 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys12-Cys63, Cys16-Cys36, Cys22-Cys46 and Cys26-Cys48
Origin	Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Synonyms	Alpha-like toxin BmK-M1, BmK I, BmK-I, BmK1, Bmk M1, BmKM1
Gene Id	para,SCN2A ,SCN3A ,SCN4A ,SCN5A ,SCN8A
Sequence	VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH-OH
Target	NaV1.4, NaV1.5, NaV1.6

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Cao, Z. et al. (2014) Toxins 6, 796. Possani, L.D. et al. (1999) Eur. J. Biochem. 264, 287. Rahnama, S. et al. (2017) PLoS One 12, e0173551.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300138-1	STB-100_0.1 mg	0.1 mg	$406		Add to Cart
BHP21300138-2	STB-100_0.5 mg	0.5 mg	$1240		Add to Cart
BHP21300138-3	STB-100_1 mg	1 mg	$1937		Add to Cart
BHP21300138-4	STB-100_5 mg	5 mg	$6464		Add to Cart
BHP21300138-5	STB-100_50 mcg	50 mcg	$235		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.