JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

BDS-II

SKU : BHP21300020

A Blocker of KV3 Channels and a Modulator of NaV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	B-450, B-450_0.1 mg, B-450_0.5 mg, B-450_1 mg, B-450_10 mg, B-450_5 mg
Description	A Blocker of KV3 Channels and a Modulator of NaV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C214H301N57O57S6
Background	BDS-II is a 43 amino acid peptidyl toxin isolated from the sea anemone Anemonia sulcata venom. BDS-II was shown to be a specific KV3.4 blocker. BDS-II blocked 70% of the KV3.4 current in COS-transfected cells at a concentration of 2.8 uM The blocking effect was rapid, direct and reversible1. Recently it was shown that BDS-II blocks other KV3 channels with similar potencies.2The closely related BDS-I was shown to modulate voltage-gated Na+ channels. It enhanced TTX-sensitive Na+ channels (highly effective on NaV1.7 channels), and weakly inhibited TTX-resistant NaV channels3. As such, we showed that BDS-II also potently inhibits NaV1.7 channels (see Our Bioassay).
Biological Activity	BDS-II blocks the KV3.4 current. The blocking effect is rapid, direct and reversible1. BDS-II also modulates voltage-gated Na+ channels (in-house data).
Formulation	Lyophilized from double distilled water (ddH2O).
Molecular Weight	4776.4 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Natural peptide
Accession Number	P59084
Concentration	100 nM - 5 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys4-Cys39, Cys6-Cys32, and Cys22-Cys40
Origin	Anemonia sulcata (Mediterranean snakelocks sea anemone).

Synonyms	DeltaKappa-actitoxin-Avd4b, Blood depressing substance II, Blood depressing substance 2
Gene Id	KCNC1,KCNC2,KCNC4,SCN9A
Sequence	AAPCFCPGKPDRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH-OH
Target	KV3 K+ channels, NaV Na+ channels

Country Of Origin	Israel/IL
Purity	>95% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Diochot, S. et al. (1998) J. Biol. Chem. 273, 6744. Yeung, S.Y. et al. (2005) J. Neurosci. 25, 8735. Liu, P. et al. (2012) J. Neurophysiol. 107, 3155. Diochot, S. et al. (1998) J. Biol. Chem. 273, 6744.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300020-1	B-450_0.1 mg	0.1 mg	$460		Add to Cart
BHP21300020-2	B-450_0.5 mg	0.5 mg	$1248		Add to Cart
BHP21300020-3	B-450_1 mg	1 mg	$1805		Add to Cart
BHP21300020-4	B-450_10 mg	10 mg	$7248		Add to Cart
BHP21300020-5	B-450_5 mg	5 mg	$5278		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.