JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

ATX-II

SKU : BHP21300136

A Modulator of NaV Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STA-700, STA-700_0.1 mg, STA-700_0.25 mg, STA-700_0.5 mg, STA-700_1 mg, STA-700_10 mg, STA-700_25 mcg, STA-700_5 mg, STA-700_50 mcg
Description	A Modulator of NaV Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C213H323N63O61S6
Background	ATX-II is a 47 amino acid peptidyl toxin, originally isolated from Anemonia sulcata sea anemone venoM It is a potent neurotoxin, which modulates voltage-gated Na+ channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes.ATX-II has been used as a powerful activator of TTX-sensitive and -insensitive Na+ channels in various excitable tissue and cell types (at concentration range of 10-100 nM).1-9
Biological Activity	ATX-II potently modulates voltage-gated Na+ channel gating kinetics by delaying its inactivation and prolonging the action potential of excitable membranes. ATX-II has been used as a powerful activator of TTX-sensitive and insensitive Na+ channels in various excitable tissue and cell types1-9.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4935 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P01528
Concentration	10 - 100 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Cited Application: Electrophysiology Is Toxin: Yes
Cas Number	60748-45-0
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys4-Cys44, Cys6-Cys34 and Cys27-Cys45
Origin	Anemonia sulcata (Mediterranean snakelocks sea anemone)

Synonyms	Neurotoxin 2, Toxin ATX-II, As2, Anemonia viridis toxin 2, Av2, Delta-actitoxin-Avd1c 2, Toxin II
Gene Id	SCN1A,SCN2A,SCN3A,SCN4A,SCN5A,SCN8A,SCN9A
Sequence	GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ-OH
Target	Various NaV channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Romey, G. et al. (1976) Proc Natl. Acad. Sci. U.S.A. 73, 4055. Tesseraux, I. et al. (1987) Naunyn Schmiedebergs Arch. Pharmacol. 336, 232. Nishio, M. et al. (1991) Br. J. Pharmacol. 104, 504. Cannon, S.C. and Corey D.P. (1993) J. Physiol. 466, 501. Hoey, A. et al. (1994) Pharmacol. Toxicol. 75, 356. Chahine, M. et al. (1996) J. Membr. Biol. 152, 39. Fletcher, J.E. et al. (1999) Anesthesiology 90, 1294. Brand, S. et al. (2000) Eur. J. Neurosci. 12, 2387. Ravens, U. (1976) Naunyn-Schmiedebergs Arch. Pharmacol. 296, 73. Romey, G. et al. (1976) Proc. Natl. Acad. U.S.A. 73, 4055. Tesseraux, I. et al. (1987) Naunyn Schmiedebergs Arch. Pharmacol. 336, 232. Nishio, M. et al. (1991) Br. J. Pharmacol. 104, 504. Cannon, S.C. and Corey, D.P. (1993) J. Physiol. 466, 501. Hoey, A. et al. (1994) Pharmacol. Toxicol. 75, 356. Chahine, M. et al. (1996) J. Membr. Biol. 152, 39. Fletcher, J.E. et al. (1999) Anesthisiology 90, 1294. Brand, S. et al. (2000) Eur. J. Neurosci. 12, 2387. Ravens, U. (1976) Naunyn Schmiedebergs Arch. Pharmacol. 296, 73.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300136-1	STA-700_0.1 mg	0.1 mg	$295		Add to Cart
BHP21300136-2	STA-700_0.25 mg	0.25 mg	$593		Add to Cart
BHP21300136-3	STA-700_0.5 mg	0.5 mg	$1034		Add to Cart
BHP21300136-4	STA-700_1 mg	1 mg	$1625		Add to Cart
BHP21300136-5	STA-700_10 mg	10 mg	$7960		Add to Cart
BHP21300136-6	STA-700_25 mcg	25 mcg	$110		Add to Cart
BHP21300136-7	STA-700_5 mg	5 mg	$5686		Add to Cart
BHP21300136-8	STA-700_50 mcg	50 mcg	$218		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.