JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

alpha-Bungarotoxin-ATTO Fluor-550

SKU : BHP21300004

A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and alpha-Bungarotoxin Binding Sites

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	B-100-AY, B-100-AY_0.1 mg
Description	A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and alpha-Bungarotoxin Binding Sites
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Background	alpha-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1. alpha-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC50 of 3.5 x 10-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission2. The toxin is selective for alpha7 receptors (IC50 value of 1.6 nM) and alpha3/beta4 receptors (IC50 value of >3 uM)3,4. alpha-Bungarotoxin also binds to and blocks a subset of GABAA receptors (GABAARs) that contain the GABAAR beta3 subunit. In particular, alpha-Bungarotoxin blocks GABAARs that contain interfaces between adjacent beta3 subunits5.
Biological Activity	alpha-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for alpha7 receptors (IC50 value of 1.6 nM) and alpha3/beta4 receptors (IC50 value of >3 uM)1,2. The toxin also blocks GABA(A) receptor subtypes3.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	~ 9134 Da
Solubility	The product is lyophilized in 0.5 ml conical vial.Centrifuge all products BEFORE adding solvent (10,000 x g for 5 minutes). The preparation of fresh solutions in working buffers before use is recommended. Soluble in pure water to high-micromolar concentrations (50 uM-1 mM). For long-term storage in solution, it is recommended to prepare a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between x100-1000 of the final working concentration. Divide the solution into single-use aliquots and store at -20°C. Before use, thaw the relevant vial(s) intended for use and dilute in the desired working buffer. Avoid multiple freeze-thaw cycles to maintain toxin activity
Source	Modified natural protein
Concentration	0.1 0.5 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys3-Cys23, Cys16-Cys44, Cys29-Cys33, Cys48-Cys and Cys60-Cys65 ATTO Fluor-550
Origin	Modified natural protein isolated from Bungarus multicinctus (Many-banded krait).

Synonyms	Long neurotoxin 1, alpha-Bgtx, alpha-BuTX
Gene Id	CHRNA1,CHRNA10,CHRNA7,CHRNA9,CHRNB1,GABRA1,GABRA2,GABRA4,GABRA5,GABRB2,GABRB3,GABRG2
Sequence	IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Target	alpha7, alpha1/beta1/gamma/delta nAChR and GABA(A) receptor subtypes

Country Of Origin	Israel/IL
Storage	Storage After Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: Avoid exposure to light. Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology, Live cell imaging, Immunofluorescence, Fluorescence staining, Direct flow cytometry

Reference	Ohta, M. et al. (1987) FEBS Lett. 222, 79. Wilson, P.T. et al. (1988) Mol. Pharmacol. 34, 643. Wilson, S.P. and Kirshner, N. (1977) J. Neurochem. 28, 687. Garcia-Guzman, M. et al. (1995) Eur. J. Neurosci. 7, 647. McCann, C.M. et al. (2006) Proc. Natl. Acad. Sci. U.S.A. 103, 5149. Wilson, S.P. and Kirshner, N. (1977) J. Neurochem. 28, 687. Garcia-Guzman, M. et al. (1995) Eur. J. Neurosci. 7, 647.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300004-1	B-100-AY_0.1 mg	0.1 mg	$266		Add to Cart
BHP21300004-2	B-100-AY_0.1 mg	5x0.1 mg	$1055		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.