JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Agitoxin-1

SKU : BHP21300123

A Potent Blocker of KV1.3 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STA-150, STA-150_0.1 mg, STA-150_0.5 mg, STA-150_1 mg, STA-150_10 mg, STA-150_5 mg, STA-150_50 mcg
Description	A Potent Blocker of KV1.3 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C169H278N52O47S7
Background	Agitoxins are peptide toxins originally isolated from L. quinquestriatus hebraeus scorpion venoM This group of toxins blocks potassium (K?) channels and has a central role in the investigation and understanding of the physiological importance of K+ channels and their function in membrane biophysics1.Agitoxins 1, 2 and 3 have been isolated and characterized. Each toxin is comprised of 38 amino acids. They are highly homologous and differ only in the identity of the residues at positions 7, 15, 29 and 31.Agitoxins appear to be specific for the Shaker K+ channel of Drosophila melanogaster and many of the mammalian homologues of Shaker. Agitoxin-1 blocks the Shaker channel in a stoichiometry of one to one, it binds the channel site in the extracellular vestibule and prevents ion conduction by occluding the pore2.Using scorpion toxins for molecular dissection of ion channels has led to direct evidence that specific mutations can be correlated to changes in the propagation and conduction of electrical impulses in the body3.
Biological Activity	Agitoxin-1 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4015 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P46110
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
Cas Number	155646-21-2
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35
Origin	Leiurus hebraeus (Hebrew deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Synonyms	K+ channel toxin alpha-KTx 3.4, Leiurotoxin-2, AgTx-1, AgTx1, Leiurotoxin II, LeTx II
Gene Id	KCNA1, KCNA3, KCNA6
Sequence	GVPINVKCTGSPQCLKPCKDAGMRFGKCINGKCHCTPK-OH
Target	KV1.3 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Bergeron, Z.L. and Bingham, J.P. (2012) Toxins 4, 1082. Garcia, M.L. et al. (1994) Biochemistry 33, 6834. Aggarwal, S.K. and MacKinnon, R. (1996) Neuron 6, 1169.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300123-1	STA-150_0.1 mg	0.1 mg	$235		Add to Cart
BHP21300123-2	STA-150_0.5 mg	0.5 mg	$672		Add to Cart
BHP21300123-3	STA-150_1 mg	1 mg	$960		Add to Cart
BHP21300123-4	STA-150_10 mg	10 mg	$4705		Add to Cart
BHP21300123-5	STA-150_5 mg	5 mg	$3360		Add to Cart
BHP21300123-6	STA-150_50 mcg	50 mcg	$202		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.