JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

Aam-KTX

SKU : BHP21300122

A Blocker of Voltage-Gated K+ channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STA-110, STA-110_0.1 mg, STA-110_0.5 mg, STA-110_1 mg, STA-110_50 mcg
Description	A Blocker of Voltage-Gated K+ channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C174H288N58O48S7
Background	KTxs are scorpion peptide toxins that act on voltage-gated K+ channels which can be divided into four groups: alpha, beta, gamma, and kappa. Aam-KTX is an analogue of Kaliotoxin that originates from Androctonus amoreuxi scorpion venoM It contains a conserved alpha-helix/beta-sheet structural motif composed of a single alpha-helix and one beta-sheet of two antiparallel strands. KTxs primarily affects voltage-gated Shaker-related and ether-a-go-go-related gene (ERG) K+ channels and Ca2+-activated K+ channels of high, intermediate, or small conductance1,2. IC50 values of Aam-KTX for KV1.3 channel and KV1.2 are 1.1 ± 0.02 and 10.4 ± 1.5 nM, respectively1.Potassium channels are a large family of membrane proteins ubiquitously distributed in excitable and nonexcitable cells. These channels play a major role in different physiological processes1.
Biological Activity	Aam-KTX is a KV1.3 channel blocker1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4185 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	P0C8R1
Concentration	0.1 - 1 nM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35 K38 - C-terminal amidation.
Origin	Androctonus amoreuxi (African fattail scorpion) (Scorpio amoreuxi)

Synonyms	Potassium channel toxin alpha-KTx 3.12, Kaliotoxin analog
Gene Id	KCNA2 ,KCNA3
Sequence	GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK-NH2
Target	KV K+ channels

Country Of Origin	Israel/IL
Purity	>=99% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Abbas, N. et al. (2008) Biochem. Biophys. Res. Commun. 376, 525. Zhu, S. et al. (2011) Mol. Cell. Proteomics. 10, M110. Abbas, N. et al. (2008) Biochem. Biophys. Res. Commun. 376, 525.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300122-1	STA-110_0.1 mg	0.1 mg	$287		Add to Cart
BHP21300122-2	STA-110_0.5 mg	0.5 mg	$747		Add to Cart
BHP21300122-3	STA-110_1 mg	1 mg	$1309		Add to Cart
BHP21300122-4	STA-110_50 mcg	50 mcg	$235		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.