JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

AaH1 Toxin

SKU : BHP21300124

A Potent NaV Channel Inhibitor of Inactivation

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STA-155, STA-155_0.1 mg, STA-155_0.5 mg, STA-155_1 mg
Description	A Potent NaV Channel Inhibitor of Inactivation
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C293H452N82O89S8
Background	AaH1 Toxin is a low molecular weight peptide toxin originally isolated from Androctonus australis scorpion venoM It blocks the fast inactivation phase of voltage-gated Na+ channels1-3. AaH1 Toxin is one of four alpha-toxins: AahI, AahII, AahIII, and AahIV which account for 95% of the venom lethality2.There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1-NaV1.9. They are responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets in numerous pathophysiological conditions such as cardiac arrhythmia and epilepsy4.
Biological Activity	AaH1 Toxin is a NaV channel activator. It blocks the fast inactivation of the channel1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	6804 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic protein
Accession Number	P01479
Concentration	1 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys12-Cys62, Cys16-Cys34, Cys20-Cys44 and Cys24-Cys46
Origin	Androctonus australis (Sahara scorpion)

Synonyms	Neurotoxin-1/1', AaH I, AaH I', AaHI/AaHI', Neurotoxin I/I'
Gene Id	SCN1A, SCN2A, SCN3A, SCN4A, SCN5A, SCN8A, SCN9A
Sequence	KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVPSGLACWCKDLPDNVPIKDTSRKCT-OH
Target	NaV channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Possani, L.D. et al. (1999) Eur. J. Biochem. 264, 287. Fabrichny, I.P. et al. (2012) J. Biol. Chem. 287, 14136. di Tommaso, A. et al. (2012) J. Biol. Chem. 287, 1414. Chow, C.Y. et al. (2015) Toxins 7, 2494. Possani, L.D. et al. (1999) Eur. J. Biochem. 264, 287.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300124-1	STA-155_0.1 mg	0.1 mg	$168		Add to Cart
BHP21300124-2	STA-155_0.5 mg	0.5 mg	$595		Add to Cart
BHP21300124-3	STA-155_1 mg	1 mg	$1019		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.