JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Proteins & Peptide / Proteins

?-Conotoxin RXIA

SKU : BHP21300233

An Activator of NaV1.6, NaV1.2 and NaV1.7 Channels

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Alomone Labs

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	STI-300, STI-300_0.1 mg, STI-300_0.5 mg, STI-300_1 mg, STI-300_10 mg, STI-300_5 mg
Description	An Activator of NaV1.6, NaV1.2 and NaV1.7 Channels
Reconstitution	Centrifuge the vial (10,000 x g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Molecular Formula	C212H310N54O69S8
Background	Iota-conotoxin RXIA (É©-Conotoxin RXIA), a peptide toxin originally isolated from Conus radiatus, is a voltage-gated sodium channel activator. The peptide toxin belongs to of the I1-superfamily, which contains eight cysteine residues arranged in a -C-C-CC-CC-C-C- pattern. Iota-RXIA is one of three characterized I1 peptides in which the third to last residue is posttranslationally isomerized to the d configuration. Naturally occurring Iota-conotoxin RXIA with d-Phe44 is significantly more active as an excitotoxin than the l-Phe analogue both in vitro and in vivo although crystallography data has shown the overall structure is only slightly altered by this shift1.Iota-conotoxin RXIA affects NaV1.6, Nav1.2 and Nav1.7 sodium channels by shifting their voltage dependence of activation to more hyperpolarized potentials2.NaV channel agonists have been isolated from the venom of different organisms and are also produced by plants, bacteria and algae. These compounds provide key insights into the molecular structure, function and pathophysiological roles of NaV channels and are important tools due to their specific subtype-selectivity1.
Biological Activity	Iota-conotoxin RXIA activates NaV1.2, NaV1.6, and NaV1.7 by shifting the voltage-dependence of activation to more hyperpolarized levels1.
Formulation	Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Molecular Weight	4975.6 Da
Solubility	Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 uM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Source	Synthetic peptide
Accession Number	Q7Z094
Concentration	1 - 10 uM
Form	Lyophilized
Notes	Bioassay Tested: yes Steril endotoxin free: no Is Toxin: Yes
UNSPSC Code	12352202
Lead Time	1-2 Business Days
Modifications	Disulfide bonds between: Cys5-Cys19, Cys12-Cys22, Cys18-Cys27, Cys21-Cys38 P2, P11, P29 - Hydroxylation D-Phenylalanine44 - D-amino acid
Origin	Conus radiatus (Rayed cone)

Synonyms	Iota-conotoxin RXIA, R11.6, r11a
Gene Id	SCN2A,SCN8A,SCN9A
Sequence	GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI-OH
Target	Nav1.6, Nav1.2 and Nav1.7 channels

Country Of Origin	Israel/IL
Purity	>=98% (HPLC)
Storage	Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Storage of solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Applications	Electrophysiology

Reference	Deuis, J.R. et al. (2017) Neuropharmacology 127, 87. Buczek, O. et al. (2007) Biochemistry 46, 9929.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHP21300233-1	STI-300_0.1 mg	0.1 mg	$768		Add to Cart
BHP21300233-2	STI-300_0.5 mg	0.5 mg	$2297		Add to Cart
BHP21300233-3	STI-300_1 mg	1 mg	$3126		Add to Cart
BHP21300233-4	STI-300_10 mg	10 mg	$17198		Add to Cart
BHP21300233-5	STI-300_5 mg	5 mg	$10944		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.