• Alternative Names :
• Tau monomer, Tau protein monomer, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Monomer, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid Tau protein fragment, Truncated Tau Protein, MAPT DeltaK280, deltaK280 Tau, K18 delta K280 Tau, truncated deltaK280 Tau

• Cellular Localization :
• Cell membrane, Cytoskeleton, Growth cone, Peripheral membrane protein, Cytoplasm, Axolemma, Axolemma Plasma Membrane, Axon, Cell Body, Cytoplasmic Ribonucleoprotein Granule, Cytoplasmic Side, Cytosol, Dendrite, Microtubule, Microtubule Associated Complex, Neurofibrillary Tangle, Neuronal Cell Body, Nuclear Periphery, Nuclear Speck, Nucleus, Plasma Membrane, Tubulin Complex

• Certificate Of Analysis :
• Certified >95% pure using SDS-PAGE analysis.

• Field Of Use :
• Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

• Scientific Background :
• Alzheimer s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The deltaK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5).

• Species :
• Human

• Specificity :
• ~15 kDa

• Concentration :
• Lot/batch specific. See included datasheet.

• Purification :
• Ion-exchange Purified

• Expression System :
• E. coli

• Amino Acid Sequence :
• MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

• Biological Activity Abreviation :
• Under Investigation

• Cite This Product :
• Human Recombinant Tau Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-476B)

• Nature :
• Recombinant

• Protein Length :
• Partial

• Gross Weight (kg) :
• 1.4

• Launch Date :
• 2019/08/28

• Net Weight (g) :
• 0.1

• Swissprot :
• P10636

• Target Details :
• Tau (K18) Delta K280 Mutant

• Gene Id :
• 4137

• Research Area :
• Tangles & Tau, Alzheimer's Disease, Axon Markers, Cell Markers, Cell Signaling, Microtubules, MT Associated Proteins, Neurodegeneration, Neuron Markers, Neuroscience, Cytoskeleton

• Antigen :
• Tau

• Adr Code :
• Non-hazardous

• Country Of Origin :
• Canada

• Tarriff Code :
• 3822.19.0030

• Un Code For Transport :
• Non-hazardous

• Unspsc Code :
• 12352202

• Shipping Temperature :
• Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

• Buffer :
• PBS pH 7.4

• Purity :
• >95%

• Storage :
• -80 °C

• Storage Buffer :
• PBS pH 7.4

• Storage Temperature :
• -80°C

• Reference :
• 1. www.alz.org/alzheimers-dementia/facts-figures<br />2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146–148 (1907)<br />3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497.<br />4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174.<br />5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723.

• Product Manual :
• <a href="https://www.stressmarq.com/wp-content/uploads/Protein-MSDS.pdf" target="_blank">Datasheet</a>

• SDS :
•