JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

Anti-SARS-CoV-2 NSP8 Antibody

SKU : BHA21003175

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

Boster

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	A34002, A34002-10ug, A34002-Biotin, A34002-Cy3, A34002-Dylight488, A34002-Dylight550, A34002-Dylight594, A34002-FITC, A34002-HRP, A34002-APC, A34002-PE, A34002-iFluor647, A34002-carrier-free
Alternative Names	Non-structural protein 8
Background	Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
Clonality	Polyclonal
Description	Boster Bio Anti-SARS-CoV-2 NSP8 Antibody catalog # A34002. Tested in ELISA applications. This antibody reacts with Human.
Function	Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
Host	Rabbit
Immunogen Region	AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Isotype	Rabbit IgG
Molecular Weight	140 kDa, 130 kDa, 110 kDa
Reactivity	Human
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Synonyms	Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp8; Non-structural protein 8
Tissue Specificity	Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .
Note	Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Uniprot	P0DTC1/P0DTD1
Gene Id	43740578
Gene Name	rep
Subcellular Location	Cytoplasm .

Conjugates	Biotin, Cy3, Dylight488, Dylight550, Dylight594, FITC, HRP, APC, PE, iFluor647, carrier-free

Concentration	Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Form	Lyophilized
Purification	Immunogen affinity purified.
Storage	Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Applications	ELISA
Description	ELISA, 0.001-0.1ug/ml, Human

Reference	1. Benedetti F, et al. J Transl Med, 2020 Aug 31.<br /><br />2. Douangamath A, et al. Nat Commun, 2020 Oct 7.<br /><br />3. Krafcikova P, et al. Nat Commun, 2020 Jul 24. <br /><br />4. Rosas-Lemus M, et al. Sci Signal, 2020 Sep 29.<br /><br />5. Vuong W, et al. Nat Commun, 2020 Aug 27.<br /><br />

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Conjugation	Size	Your price	Quantity
BHA21003175-1	A34002	-	100 ug	$415		Add to Cart
BHA21003175-2	A34002-10ug	Sample	10 ug	$99		Add to Cart
BHA21003175-3	A34002-Biotin	Biotin	100 ug	$615		Add to Cart
BHA21003175-4	A34002-Cy3	Cy3	100 ug	$615		Add to Cart
BHA21003175-5	A34002-Dylight488	Dylight488	100 ug	$615		Add to Cart
BHA21003175-6	A34002-Dylight550	Dylight550	100 ug	$615		Add to Cart
BHA21003175-7	A34002-Dylight594	Dylight594	100 ug	$615		Add to Cart
BHA21003175-8	A34002-FITC	FITC	100 ug	$615		Add to Cart
BHA21003175-9	A34002-HRP	HRP	100 ug	$615		Add to Cart
BHA21003175-10	A34002-APC	APC	100 ug	$715		Add to Cart
BHA21003175-11	A34002-PE	PE	100 ug	$715		Add to Cart
BHA21003175-12	A34002-iFluor647	iFluor647	100 ug	$715		Add to Cart
BHA21003175-13	A34002-carrier-free	carrier-free	100 ug	$415		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2025 Biohippo. All rights reserved.