JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

SOX10 Antibody

SKU : BHA17108939

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	RQ4045
Clonality	Polyclonal
Description	Transcription factor SOX-10 is a protein that in humans is encoded by the SOX10 gene. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL from the human protein were used as the immunogen for the SOX10 antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Antigen	SOX10
Uniprot	P56693

Buffer	Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Format	Antigen affinity purified
Purification	Antigen affinity purified
Storage	After reconstitution, the SOX10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB, FACS
Dilution	Western Blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells

Product Manual	Data Sheet

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17108939	RQ4045	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.