OGT Antibody / O-GlcNAc transferase subunit p110

Mfr.No.	R31809
Clonality	Polyclonal
Description	O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA of human OGT were used as the immunogen for the OGT antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Mouse, Rat, Human
Recombinant	No
Subcellular Location	Nuclear, cytoplasmic

Antigen	OGT
Uniprot	O15294

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the OGT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, IF, WB, FACS
Dilution	Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells