NTCP Antibody / SLC10A1

Mfr.No.	R31795
Clonality	Polyclonal
Description	Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Rat, Mouse, Human
Recombinant	No
Subcellular Location	Membrane

Antigen	SLC10A1
Uniprot	O08705

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the NTCP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IF, FACS, IHC-F, IHC-P, WB
Dilution	Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunohistochemistry (Frozen): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence (FFPE): 1-2ug/ml