JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

NQO1 Antibody

SKU : BHA17105326

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R31977
Clonality	Polyclonal
Description	This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK of human NQO1 were used as the immunogen for the NQO1 antibody.
Isotype	IgG
Predicted Reactivity	Human, Rat
Reactivity	Rat, Human
Recombinant	No

Antigen	NQO1
Uniprot	P15559

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the NQO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Western blot: 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHA17105326-1	R31977	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.