JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

KIM1 Antibody / HAVCR1

SKU : BHA17105635

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32305
Clonality	Polyclonal
Description	Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. (UniProt)
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Antigen	KIM-1
Uniprot	Q96D42

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the KIM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Western blot: 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105635	R32305	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.