JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

HDAC6 Antibody

SKU : BHA17105670

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32342
Clonality	Polyclonal
Description	HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD of human HDAC6 were used as the immunogen for the HDAC6 antibody.
Isotype	IgG
Predicted Reactivity	Human, Rat
Reactivity	Rat, Human
Recombinant	No

Antigen	HDAC6
Uniprot	Q9UBN7

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the HDAC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Western blot: 0.1-0.5ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105670	R32342	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.