JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

GRP78 Antibody / BiP / HSPA5

SKU : BHA17105288

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R31939
Clonality	Polyclonal
Description	HSPA5 (heat shock 70kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No
Subcellular Location	Cytoplasmic, membrane

Antigen	GRP78
Uniprot	P11021

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the GRP78 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, WB
Dilution	Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

SKU	Supplier No.	Size	Your price	Quantity
BHA17105288	R31939	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.