JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

GRK3 Antibody / ADRBK2

SKU : BHA17105422

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32079
Clonality	Polyclonal
Description	Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.
Isotype	IgG
Predicted Reactivity	Human
Reactivity	Human
Recombinant	No

Antigen	GRK3
Uniprot	P35626

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the GRK3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	WB
Dilution	Western blot: 0.1-0.5ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHA17105422-1	R32079	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.