DDAH1 Antibody

Mfr.No.	R32437
Clonality	Polyclonal
Description	DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN were used as the immunogen for the DDAH1 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Mouse, Rat, Human
Recombinant	No

Antigen	DDAH1
Uniprot	O94760

Buffer	Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Format	Antigen affinity purified
Purification	Antigen affinity
Storage	Prior to reconstitution, store at 4°C. After reconstitution, the DDAH1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, FACS, WB, IF
Dilution	Western blot: 0.5-1ug/ml (mouse/rat); 2-4ug/ml (human),Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence: 2-4ug/ml