CK19 Antibody / Cytokeratin 19

Mfr.No.	R31920
Clonality	Polyclonal
Description	Cytokeratin 19, also called Keratin 19 and CK19, is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, CK19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR of human KRT19 were used as the immunogen for the CK19 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Mouse, Rat, Human
Recombinant	No
Subcellular Location	Cytoplasmic

Antigen	Cytokeratin 19
Uniprot	P08727

Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the CK19 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, IF, WB, FACS
Dilution	Western blot: 0.1-0.5ug/ml,Immunohistochemisty (FFPE): 0.5-1ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells