Cdc20 Antibody

Mfr.No.	R32832
Clonality	Polyclonal
Description	The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This genes most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT were used as the immunogen for the Cdc20 antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Mouse, Rat, Human
Recombinant	No

Antigen	Cdc20
Uniprot	Q12834

Buffer	Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the Cdc20 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, IF, WB, FACS
Dilution	Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells