JavaScript is currently not supported/disabled by this browser. Please enable JavaScript for full functionality.

Call Us 1 - 866 - 986 - 9598
orders@biohippo.com

Sign Up

Login
- My Order
- Return Requests
- Track my Order

Home / Primary Antibodies / Polyclonal Antibodies

Annexin IV Antibody

SKU : BHA17105989

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Request More Infos

NSJ Bioreagents

view supplier details

Order Now

Credit card payments now incur a 3% fee.

Contact us to order

Tel

+1 866.986.9598

Email

orders@biohippo.com

Get a Quote

Ask Merchant

Request More Infos

Sample Request

Mfr.No.	R32677
Clonality	Polyclonal
Description	ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells.
Formulation	0.5mg/ml if reconstituted with 0.2ml sterile DI water
Host	Rabbit
Immunogen Region	Amino acids 119-152 (EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL) from the human protein were used as the immunogen for the Annexin IV antibody.
Isotype	IgG
Predicted Reactivity	Human, Mouse, Rat
Reactivity	Human, Mouse, Rat
Recombinant	No

Antigen	Annexin IV
Uniprot	P09525

Buffer	Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Format	Antigen affinity purified
Purification	Antigen affinity
Storage	After reconstitution, the Annexin IV antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Applications	IHC-P, WB
Dilution	Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml

Product Manual	Data Sheet

No Description Available.

No Description Available.

Have you used this product?

Rate it now..!!

Login to Review

Combination SKU	Supplier No.	Size	Your price	Quantity
BHA17105989-1	R32677	100ug	$439		Add to Cart

ebiohippo.com provides biomedical researchers with a one-stop informatic shopping experience by transforming biotechnology products’ data into a ready-to-analyze state. We collect and unify suppliers’ data on a single platform to reduce the time of searching, uncertainty, and cost of scientific experiments.

© 2026 Biohippo. All rights reserved.